Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 3.25

Knowledge Summary

Patent (262)

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 3.1e-06

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.236 3.1e-06

AA Sequence

MDNSNWTSVSHFVLLGISTHPEEQIPLFLVFSLMYAINISGNLAIITLILSAPRLHIPMYIFLSNLALTD      1 - 70
ICFTSTTVPKMLQIIFSPTKVISYTGCLAQTYFFICFAVMENFILAVMAYDRYIAICHPFHYTMILTRML     71 - 140
CVKMVVMCHALSHLHAMLHTFLIGQLIFCADNRIPHFFCDLYALMKISCTSTYLNTLMIHTEGAVVISGA    141 - 210
LAFITASYACIILVVLRIPSAKGRWKTFSTCGSHLTVVAIFYGTLSWVYFRPLSSYSVTKGRIITVVYTV    211 - 280
VTPMLNPFIYSLRNGDVKGGFMKWMSRMQTFFFR                                        281 - 314
//

Text Mined References (6)

PMID Year Title