Property Summary

NCBI Gene PubMed Count 22
PubMed Score 20.00
PubTator Score 22.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -4.600 0.000
osteosarcoma 2.440 0.001
astrocytoma -1.400 0.047
medulloblastoma, large-cell -1.200 0.002
tuberculosis and treatment for 3 months -1.100 0.001
non-small cell lung cancer -1.141 0.000
colon cancer -1.700 0.000
group 3 medulloblastoma -1.300 0.037
subependymal giant cell astrocytoma -2.946 0.010
spina bifida -1.613 0.038
Breast cancer -1.200 0.000
ductal carcinoma in situ -1.300 0.000
invasive ductal carcinoma -2.100 0.000
ovarian cancer -3.200 0.000

Synonym

Gene

PANTHER Protein Class (1)

PDB

3PZ7  

Gene RIF (14)

PMID Text
25648220 DIXDC1 was overexpressed in gastric cancer and correlated with poor prognosis.
25042806 DIXDC1 depletion results in upregulation of Snail1 in a FAK-dependent manner, leading to increased cell invasion. MARK1 phosphorylation of DIXDC1 is required for its localization to focal adhesions and ability to suppress metastasis in mice.
23813858 DIXDC1 is associated with stage and prognosis in non-small cell lung cancer, and may promote invasion and migration through PI3K-AKT/AP-1-dependent activation of metalloproteinases
22832659 Transgenic DIXDC1 might contribute to pathophysiology underlying abnormal behaviors in schizophrenia and other major psychiatric disorders in mice.
21189423 a molecular mechanism for Ccd1-mediated Wnt activation in that Ccd1 converts latent polymeric Dvl to a biologically active oligomer(s).
20624590 This study reveal that Dixdc1 integrates DISC1 into Wnt-GSK3beta/beta-catenin-dependent and -independent signaling pathways during cortical development and further delineate how DISC1 contributes to neuropsychiatric disorders.
20085589 Wnt/beta-catenin pathway activation might upregulate DIXDC1 through a post-translational mechanism by inhibiting the ubiquitin-mediated degradation of the DIXDC1 protein.
19572978 over-expression of DIXDC1 might target p21 and cyclin D1 to promote colon cancer cell proliferation and tumorigenesis at least partially through activation of the PI3K/Akt pathway.
19375513 The GFP-tag fused DIXDC1 exogenously expressed co-localize with gamma-tubulin both at interphase and mitotic phase in the centrosomes.
18629627 DIXDC1 might play an important role during neurogenesis, overexpression of DIXDC1 in embryonic carcinoma P19 cells promoted neuronal differentiation, and inhibited gliogenesis induced by retinoic acid.
More...

AA Sequence

MLACLTRGNLLDVLQEGFNEQQLQAYVAWVNAQLKKRPAVKPVQDLRQDLRDGVILAYLIEIVAGEKLSG      1 - 70
VQLSPGNQQEMKNNVEKVLQFVASKKIRMHQTSAKDIVDGNLKSIMRLVLALAAHFKPGSSRTVNQGRDS     71 - 140
RAPLQSHRPHCATAVAQGAAAALADVCHDMSRSGRDVFRYRQRNSSMDEEIENPYWSVRALVQQYEGQQR    141 - 210
SPSESSCSSLTSPSPIHSAKSESIITQSEEKADFVIIPAEGIENRTEGTDSPLSRDWRPGSPGTYLETSW    211 - 280
EEQLLEQQEYLEKEMEEAKKMISGLQALLLNGSLPEDEQERPLALCEPGVNPEEQLIIIQSRLDQSMEEN    281 - 350
QDLKKELLKCKQEARNLQGIKDALQQRLTQQDTSVLQLKQELLRANMDKDELHNQNVDLQRKLDERNRLL    351 - 420
GEYKKELGQKDRLLQQHQAKLEEALRKLSDVSYHQVDLERELEHKDVLLAHCMKREADEATNYNSHNSQS    421 - 490
NGFLLPTAGKGATSVSNRGTSDLQLVRDALRSLRNSFSGHDPQHHTIDSLEQGISSLMERLHVMETQKKQ    491 - 560
ERKVRVKSPRTQVGSEYRESWPPNSKLPHSQSSPTVSSTCTKVLYFTDRSLTPFMVNIPKRLEEVTLKDF    561 - 630
KAAIDREGNHRYHFKALDPEFGTVKEEIFHDDDAIPGWEGKIVAWVEEDHGEN                     631 - 683
//

Text Mined References (29)

PMID Year Title
25648220 2016 DIXDC1 activates the Wnt signaling pathway and promotes gastric cancer cell invasion and metastasis.
25042806 2014 An AMPK-independent signaling pathway downstream of the LKB1 tumor suppressor controls Snail1 and metastatic potential.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23813858 2014 DIXDC1 increases the invasion and migration ability of non-small-cell lung cancer cells via the PI3K-AKT/AP-1 pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22832659 2011 Abnormal behavior in mice mutant for the Disc1 binding partner, Dixdc1.
21189423 2011 Molecular basis of Wnt activation via the DIX domain protein Ccd1.
20823832 2010 Dishevelled, a Wnt signalling component, is involved in mitotic progression in cooperation with Plk1.
20624590 2010 Dixdc1 is a critical regulator of DISC1 and embryonic cortical development.
20213681 2010 Strategy for comprehensive identification of human N-myristoylated proteins using an insect cell-free protein synthesis system.
More...