Property Summary

NCBI Gene PubMed Count 26
PubMed Score 21.47
PubTator Score 22.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma -1.400 4.7e-02
Breast cancer -1.200 2.6e-05
colon cancer -1.700 4.9e-04
ductal carcinoma in situ -1.300 4.9e-04
group 3 medulloblastoma -1.300 3.7e-02
invasive ductal carcinoma -2.100 2.9e-04
malignant mesothelioma -4.600 5.4e-08
medulloblastoma, large-cell -1.200 2.1e-03
non-small cell lung cancer -1.141 6.1e-11
osteosarcoma 1.484 2.2e-06
ovarian cancer -3.200 2.9e-17
spina bifida -1.613 3.8e-02
subependymal giant cell astrocytoma -2.946 9.8e-03
tuberculosis and treatment for 3 months -1.100 1.1e-03

Gene RIF (18)

AA Sequence

MLACLTRGNLLDVLQEGFNEQQLQAYVAWVNAQLKKRPAVKPVQDLRQDLRDGVILAYLIEIVAGEKLSG      1 - 70
VQLSPGNQQEMKNNVEKVLQFVASKKIRMHQTSAKDIVDGNLKSIMRLVLALAAHFKPGSSRTVNQGRDS     71 - 140
RAPLQSHRPHCATAVAQGAAAALADVCHDMSRSGRDVFRYRQRNSSMDEEIENPYWSVRALVQQYEGQQR    141 - 210
SPSESSCSSLTSPSPIHSAKSESIITQSEEKADFVIIPAEGIENRTEGTDSPLSRDWRPGSPGTYLETSW    211 - 280
EEQLLEQQEYLEKEMEEAKKMISGLQALLLNGSLPEDEQERPLALCEPGVNPEEQLIIIQSRLDQSMEEN    281 - 350
QDLKKELLKCKQEARNLQGIKDALQQRLTQQDTSVLQLKQELLRANMDKDELHNQNVDLQRKLDERNRLL    351 - 420
GEYKKELGQKDRLLQQHQAKLEEALRKLSDVSYHQVDLERELEHKDVLLAHCMKREADEATNYNSHNSQS    421 - 490
NGFLLPTAGKGATSVSNRGTSDLQLVRDALRSLRNSFSGHDPQHHTIDSLEQGISSLMERLHVMETQKKQ    491 - 560
ERKVRVKSPRTQVGSEYRESWPPNSKLPHSQSSPTVSSTCTKVLYFTDRSLTPFMVNIPKRLEEVTLKDF    561 - 630
KAAIDREGNHRYHFKALDPEFGTVKEEIFHDDDAIPGWEGKIVAWVEEDHGEN                     631 - 683
//

Text Mined References (33)

PMID Year Title