Property Summary

NCBI Gene PubMed Count 69
Grant Count 139
R01 Count 111
Funding $9,049,189.55
PubMed Score 69.30
PubTator Score 62.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 3.000 0.000
psoriasis -1.900 0.007
osteosarcoma -1.813 0.000

Synonym

Accession Q15599 D3DU84 D3DU85 H3BSV6 O00272 O00556 Q3KQY7 NHERF-2
Symbols SIP1
OCTS2
SIP-1
TKA-1
E3KARP
NHERF2
NHE3RF2
NHERF-2

Gene

PDB

4P0C   2D11   2HE4   2OCS  

 GO Process (1)

Gene RIF (30)

PMID Text
26310448 Moreover, the S303D mutation enhances the in vivo dynamics of the E3KARP tail alone, whereas in vitro the interaction of E3KARP with active ezrin is unaffected by S303D
24760985 Lysophosphatidic acid stimulation of NHE3 exocytosis in polarized epithelial cells occurs with release from NHERF2 via ERK-PLC-PKCdelta signaling.
24613836 Crystal structure of NHERF2 PDZ1 domain complex with C-terminal LPA2 sequence. The PDZ1-LPA2 binding specificity is achieved by hydrogen bonds and hydrophobic contacts with the last four LPA2 residues contributing to specific interactions.
23985317 Data indicate that the tails promote different microvillar localizations for EBP50 and E3KARP, which localized along the full length and to the base of microvilli, respectively.
23612977 NHERF2 domain was functionally significant in NHE3 regulation, being necessary for stimulation by lysophosphatidic acid of activity and increased mobility of NHE3
23284683 functional regulation of C3aR by NHERFs in human mast cells
22587461 AnxA2 and NHERF2 form a scaffold complex that links adjacent Tir molecules at the plasma membrane forming a lattice that could be involved in retention and dissemination of other effectors at the bacterial attachment site.
22371496 CaMKII inhibition of NHE3 reguires NHEF2.
22343917 NHERF-2 is a negative regulator of endothelial proliferation and may have important roles in endothelial homeostasis and vascular modeling.
22082156 Knockdown of solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3 regulator 2 (SLC9A3R2) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
More...

AA Sequence

MAAPEPLRPRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGVNVEGETHH      1 - 70
QVVQRIKAVEGQTRLLVVDQETDEELRRRQLTCTEEMAQRGLPPAHDPWEPKPDWAHTGSHSSEAGKKDV     71 - 140
SGPLRELRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHA    141 - 210
EVVASIKAREDEARLLVVDPETDEHFKRLRVTPTEEHVEGPLPSPVTNGTSPAQLNGGSACSSRSDLPGS    211 - 280
DKDTEDGSAWKQDPFQESGLHLSPTAAEAKEKARAMRVNKRAPQMDWNRKREIFSNF                 281 - 337
//

Text Mined References (76)

PMID Year Title
26310448 2015 The function and dynamics of the apical scaffolding protein E3KARP are regulated by cell-cycle phosphorylation.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24760985 2014 Lysophosphatidic acid stimulation of NHE3 exocytosis in polarized epithelial cells occurs with release from NHERF2 via ERK-PLC-PKC? signaling.
24613836 2014 Structural insights into PDZ-mediated interaction of NHERF2 and LPA(2), a cellular event implicated in CFTR channel regulation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23985317 2013 The tails of apical scaffolding proteins EBP50 and E3KARP regulate their localization and dynamics.
23612977 2013 NHERF2 protein mobility rate is determined by a unique C-terminal domain that is also necessary for its regulation of NHE3 protein in OK cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...