Property Summary

NCBI Gene PubMed Count 154
PubMed Score 142.60
PubTator Score 181.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
aldosterone-producing adenoma -1.044 2.9e-02
atypical teratoid / rhabdoid tumor 1.600 1.2e-03
Crohn's disease -1.005 9.5e-03
Gaucher disease type 1 -1.800 4.9e-03
glioblastoma 1.200 1.6e-02
interstitial cystitis -1.100 2.5e-04
intraductal papillary-mucinous neoplasm ... 2.300 5.6e-03
medulloblastoma 1.400 1.8e-02
medulloblastoma, large-cell 2.000 8.6e-04
Multiple myeloma 1.082 2.0e-02
osteosarcoma 2.242 3.1e-04
psoriasis -1.600 1.1e-04
ulcerative colitis -1.289 1.5e-02

Synonym

Accession Q15596 Q14CD2 NCoA-2
Symbols SRC2
TIF2
GRIP1
KAT13C
NCoA-2
bHLHe75

Gene

PDB

4QE6   4QE8   5IAW   5ICK   5Q17   1GWQ   1GWR   1ZKY   2B1V   2B1Z   2B23   2FAI   2G44   2G5O   2P15   3ERD   3Q95   4IU7   4IUI   4IV2   4IV4   4IVW   4IVY   4IW6   4IW8   4IWC   4IWF   4PP6   4PPP   4PPS   4PXM   4Q13   4ZN7   4ZN9   4ZNH   4ZNS   4ZNT   4ZNU   4ZNV   4ZNW   5DI7   5DID   5DIE   5DIG   5DK9   5DKB   5DKE   5DKG   5DKS   5DL4   5DLR   5DMC   5DMF   5DP0   5DRJ   5DRM   5DTV   5DU5   5DUE   5DUG   5DUH   5DVS   5DVV   5DWE   5DWG   5DWI   5DWJ   5DX3   5DXB   5DXE   5DXG   5DXK   5DXM   5DXP   5DXQ   5DXR   5DY8   5DYB   5DYD   5DZ0   5DZ1   5DZ3   5DZH   5DZI   5E0W   5E0X   5E14   5E15   5E19   5E1C   5EGV   5EHJ   5EI1   5EIT   5HYR   5KCC   5KCD   5KCE   5KCF   5KCT   5KCU   5KCW   5KD9   5KR9   5KRA   5KRC   5KRF   5KRH   5KRI   5KRJ   5KRK   5KRL   5KRM   5KRO   5T1Z   5TLD   5TLF   5TLG   5TLL   5TLM   5TLO   5TLP   5TLT   5TLU   5TLV   5TLX   5TLY   5TM1   5TM2   5TM3   5TM4   5TM5   5TM6   5TM7   5TM8   5TM9   5TML   5TMM   5TMO   5TMQ   5TMR   5TMS   5TMT   5TMU   5TMV   5TMW   5TMZ   5TN1   5TN3   5TN4   5TN5   5TN6   5TN7   5TN8   5U2D   4IQR   3KYT   3L0J   3L0L   4NIE   5APH   5APJ   5G42   5G43   5G44   5G45   5G46   5VB3   5VB5   5VB6   5VB7   1UHL   5I4V   3DZU   3DZY   3E00   1T63   1T65   2AO6   2Q7J   2Q7L   3A9E   5UAN   4ZO1   1YOK   1ZDU   3PLZ   4DOS   4PLD   4PLE   5L11   5SYZ   2YJD   1M2Z   1MV9   1MVC   1MZN   1P93   1ZDT   2LDC   2P1T   2P1U   2P1V   2ZXZ   2ZY0   3CLD   3E7C   3E94   3FUG   3GN8   3K22   3K23   3KWY   3L0E   3O1D   3O1E   3OAP   3OZJ   3PCU   3R5M   3UP0   3UP3   4CSJ   4E2J   4FHH   4FHI   4IA1   4IA2   4IA3   4IA7   4K4J   4K6I   4M8E   4M8H   4NQA   4OC7   4P6W   4P6X   4POH   4POJ   4PP3   4PP5   4Q0A   4RFW   4RMC   4RMD   4RME   4RUO   4UDC   4UDD   4WG0   4ZSH   5EC9   5G3J   5G5W   5H1E   5LGA   5LYQ   5MK4   5NFP   5NFT  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (4)

Gene RIF (85)

AA Sequence

MSGMGENTSDPSRAETRKRKECPDQLGPSPKRNTEKRNREQENKYIEELAELIFANFNDIDNFNFKPDKC      1 - 70
AILKETVKQIRQIKEQEKAAAANIDEVQKSDVSSTGQGVIDKDALGPMMLEALDGFFFVVNLEGNVVFVS     71 - 140
ENVTQYLRYNQEELMNKSVYSILHVGDHTEFVKNLLPKSIVNGGSWSGEPPRRNSHTFNCRMLVKPLPDS    141 - 210
EEEGHDNQEAHQKYETMQCFAVSQPKSIKEEGEDLQSCLICVARRVPMKERPVLPSSESFTTRQDLQGKI    211 - 280
TSLDTSTMRAAMKPGWEDLVRRCIQKFHAQHEGESVSYAKRHHHEVLRQGLAFSQIYRFSLSDGTLVAAQ    281 - 350
TKSKLIRSQTTNEPQLVISLHMLHREQNVCVMNPDLTGQTMGKPLNPISSNSPAHQALCSGNPGQDMTLS    351 - 420
SNINFPINGPKEQMGMPMGRFGGSGGMNHVSGMQATTPQGSNYALKMNSPSQSSPGMNPGQPTSMLSPRH    421 - 490
RMSPGVAGSPRIPPSQFSPAGSLHSPVGVCSSTGNSHSYTNSSLNALQALSEGHGVSLGSSLASPDLKMG    491 - 560
NLQNSPVNMNPPPLSKMGSLDSKDCFGLYGEPSEGTTGQAESSCHPGEQKETNDPNLPPAVSSERADGQS    561 - 630
RLHDSKGQTKLLQLLTTKSDQMEPSPLASSLSDTNKDSTGSLPGSGSTHGTSLKEKHKILHRLLQDSSSP    631 - 700
VDLAKLTAEATGKDLSQESSSTAPGSEVTIKQEPVSPKKKENALLRYLLDKDDTKDIGLPEITPKLERLD    701 - 770
SKTDPASNTKLIAMKTEKEEMSFEPGDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSVDKQAII    771 - 840
NDLMQLTAENSPVTPVGAQKTALRISQSTFNNPRPGQLGRLLPNQNLPLDITLQSPTGAGPFPPIRNSSP    841 - 910
YSVIPQPGMMGNQGMIGNQGNLGNSSTGMIGNSASRPTMPSGEWAPQSSAVRVTCAATTSAMNRPVQGGM    911 - 980
IRNPAASIPMRPSSQPGQRQTLQSQVMNIGPSELEMNMGGPQYSQQQAPPNQTAPWPESILPIDQASFAS    981 - 1050
QNRQPFGSSPDDLLCPHPAAESPSDEGALLDQLYLALRNFDGLEEIDRALGIPELVSQSQAVDPEQFSSQ   1051 - 1120
DSNIMLEQKAPVFPQQYASQAQMAQGSYSPMQDPNFHTMGQRPSYATLRMQPRPGLRPTGLVQNQPNQLR   1121 - 1190
LQLQHRLQAQQNRQPLMNQISNVSNVNLTLRPGVPTQAPINAQMLAQRQREILNQHLRQRQMHQQQQVQQ   1191 - 1260
RTLMMRGQGLNMTPSMVAPSGMPATMSNPRIPQANAQQFPFPPNYGISQQPDPGFTGATTPQSPLMSPRM   1261 - 1330
AHTQSPMMQQSQANPAYQAPSDINGWAQGNMGGNSMFSQQSPPHFGQQANTSMYSNNMNINVSMATNTGG   1331 - 1400
MSSMNQMTGQISMTSVTSVPTSGLSSMGPEQVNDPALRGGNLFPNQLPGMDMIKQEGDTTRKYC         1401 - 1464
//

Text Mined References (172)

PMID Year Title