Property Summary

NCBI Gene PubMed Count 144
Grant Count 71
R01 Count 30
Funding $3,944,576.55
PubMed Score 135.37
PubTator Score 181.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Multiple myeloma 1.082 0.020
psoriasis -1.600 0.000
osteosarcoma 2.242 0.000
atypical teratoid / rhabdoid tumor 1.600 0.001
glioblastoma 1.200 0.016
medulloblastoma 1.400 0.018
medulloblastoma, large-cell 2.000 0.001
Crohn's disease -1.005 0.010
ulcerative colitis -1.289 0.015
intraductal papillary-mucinous neoplasm ... 2.300 0.006
interstitial cystitis -1.100 0.000
aldosterone-producing adenoma -1.044 0.029
Gaucher disease type 1 -1.800 0.005

Synonym

Accession Q15596 Q14CD2 NCoA-2
Symbols SRC2
TIF2
GRIP1
KAT13C
NCoA-2
bHLHe75

Gene

PDB

4QE6   4QE8   1GWQ   1GWR   1ZKY   2B1V   2B1Z   2B23   2FAI   2G44   2G5O   2P15   3ERD   3Q95   3Q97   4IU7   4IUI   4IV2   4IV4   4IVW   4IVY   4IW6   4IW8   4IWC   4IWF   4PP6   4PPP   4PPS   4PXM   4ZN7   4ZN9   4ZNH   4ZNS   4ZNT   4ZNU   4ZNV   4ZNW   4ZUB   4ZUC   4ZWH   4ZWK   5BNU   5BP6   5BPR   5BQ4   5DI7   5DID   5DIE   5DIG   5DK9   5DKB   5DKE   5DKG   5DKS   5DL4   5DLR   5DMC   5DMF   5DP0   5DRJ   5DRM   5DTV   5DU5   5DUE   5DUG   5DUH   5DVS   5DVV   5DWE   5DWG   5DWI   5DWJ   5DX3   5DXB   5DXE   5DXK   5DXM   5DXP   5DXQ   5DXR   5DY8   5DYB   5DYD   5DZ0   5DZ1   5DZ3   5DZH   5DZI   5E0W   5E0X   5E14   5E15   5E19   5E1C   5EGV   5EHJ   5EI1   5EIT   5HYR   4IQR   3KYT   3L0J   3L0L   4NIE   5APH   5APJ   5G42   5G43   5G44   5G45   5G46   1UHL   5I4V   3DZU   3DZY   3E00   1T63   1T65   2AO6   2Q7J   2Q7L   3A9E   4ZO1   1YOK   1ZDU   3PLZ   4DOS   4PLD   4PLE   2YJD   1M2Z   1MV9   1MVC   1MZN   1P93   1ZDT   2LDC   2P1T   2P1U   2P1V   2ZXZ   2ZY0   3CLD   3E7C   3E94   3FUG   3GN8   3K22   3K23   3KWY   3L0E   3O1D   3O1E   3OAP   3OZJ   3PCU   3R5M   3UP0   3UP3   4CSJ   4E2J   4FHH   4FHI   4IA1   4IA2   4IA3   4IA7   4K4J   4K6I   4M8E   4M8H   4NQA   4OC7   4P6W   4P6X   4POH   4POJ   4PP3   4PP5   4Q0A   4RFW   4RMC   4RMD   4RME   4RUO   4UDC   4UDD   4WG0   4ZSH   5EC9  

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
651782 confirmatory 2 / 0 / 6 Late stage Counterscreen for the probe development effort to identify inhibitors of the Steroid Receptor Coactivator 3 (SRC3; NCOA3): Luminescence-based cell-based dose response assay to identify inhibitors of the Steroid Receptor Coactivator 2 (SRC2; NCOA2)
651799 confirmatory 1 / 0 / 2 Late stage Counterscreen for the probe development effort to identify inhibitors of the Steroid Receptor Coactivator 1 (SRC1; NCOA1): Luminescence-based cell-based dose response assay to identify inhibitors of the Steroid Receptor Coactivator 2 (SRC2; NCOA2)
651957 screening 620 / 0 / 368625 Luminescence-based cell-based primary high throughput screening assay to identify inhibitors of the Steroid Receptor Coactivator 2 (SRC2; NCOA2)
651960 summary 0 / 0 / 0 Summary of the probe development effort to identify inhibitors of the Steroid Receptor Coactivator 2 (SRC2; NCOA2)
652008 screening 657 / 0 / 1205 Luminescence-based cell-based high throughput confirmation assay to identify inhibitors of the Steroid Receptor Coactivator 2 (SRC2; NCOA2)

Gene RIF (80)

PMID Text
26799514 evaluating if NCOA2 relative copy-number gain presents prognostic value for prostate cancer
26553876 Data suggest that LRH1/NR5A2 (liver receptor homologue-1) exhibits phospholipid-mediated allosteric control of protein-protein binding interface in interactions with TIF2 and SHP (co-repressor; small heterodimer partner protein).
26350169 Report NcoA2-regulation of the AhR-ARNT-HIF-1a interaction.
26267537 Data suggest that over-stimulating the steroid seceptor coactivators SRC-1, SRC-2, and SRC-3 oncogenic program can be an effective strategy to kill cancer cells.
26261634 Suggest a possible association between NCOA2 rs10504473 polymorphism and obesity in Chinese Han population.
26066330 miR-137 has a role in targeting p160 steroid receptor coactivators SRC1, SRC2, and SRC3 and inhibits cell proliferation
25986860 results suggest that CCNC temporarily protects SRC-2 against degradation and this event is involved in the transcriptional regulation of SRC-2 cell cycle target genes.
25823027 NCOA2 is a novel negative growth regulatory gene repressing the Wnt/beta-catenin pathway in colorectal cancer, where recurrent fusion with LACTB2 contributes to its disruption.
25664849 SRC-2 is a prominent metabolic coordinator of cancer metastasis.
24905738 increased levels of SRC-2 impairs murine endometrial function
More...

AA Sequence

MSGMGENTSDPSRAETRKRKECPDQLGPSPKRNTEKRNREQENKYIEELAELIFANFNDIDNFNFKPDKC      1 - 70
AILKETVKQIRQIKEQEKAAAANIDEVQKSDVSSTGQGVIDKDALGPMMLEALDGFFFVVNLEGNVVFVS     71 - 140
ENVTQYLRYNQEELMNKSVYSILHVGDHTEFVKNLLPKSIVNGGSWSGEPPRRNSHTFNCRMLVKPLPDS    141 - 210
EEEGHDNQEAHQKYETMQCFAVSQPKSIKEEGEDLQSCLICVARRVPMKERPVLPSSESFTTRQDLQGKI    211 - 280
TSLDTSTMRAAMKPGWEDLVRRCIQKFHAQHEGESVSYAKRHHHEVLRQGLAFSQIYRFSLSDGTLVAAQ    281 - 350
TKSKLIRSQTTNEPQLVISLHMLHREQNVCVMNPDLTGQTMGKPLNPISSNSPAHQALCSGNPGQDMTLS    351 - 420
SNINFPINGPKEQMGMPMGRFGGSGGMNHVSGMQATTPQGSNYALKMNSPSQSSPGMNPGQPTSMLSPRH    421 - 490
RMSPGVAGSPRIPPSQFSPAGSLHSPVGVCSSTGNSHSYTNSSLNALQALSEGHGVSLGSSLASPDLKMG    491 - 560
NLQNSPVNMNPPPLSKMGSLDSKDCFGLYGEPSEGTTGQAESSCHPGEQKETNDPNLPPAVSSERADGQS    561 - 630
RLHDSKGQTKLLQLLTTKSDQMEPSPLASSLSDTNKDSTGSLPGSGSTHGTSLKEKHKILHRLLQDSSSP    631 - 700
VDLAKLTAEATGKDLSQESSSTAPGSEVTIKQEPVSPKKKENALLRYLLDKDDTKDIGLPEITPKLERLD    701 - 770
SKTDPASNTKLIAMKTEKEEMSFEPGDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSVDKQAII    771 - 840
NDLMQLTAENSPVTPVGAQKTALRISQSTFNNPRPGQLGRLLPNQNLPLDITLQSPTGAGPFPPIRNSSP    841 - 910
YSVIPQPGMMGNQGMIGNQGNLGNSSTGMIGNSASRPTMPSGEWAPQSSAVRVTCAATTSAMNRPVQGGM    911 - 980
IRNPAASIPMRPSSQPGQRQTLQSQVMNIGPSELEMNMGGPQYSQQQAPPNQTAPWPESILPIDQASFAS    981 - 1050
QNRQPFGSSPDDLLCPHPAAESPSDEGALLDQLYLALRNFDGLEEIDRALGIPELVSQSQAVDPEQFSSQ   1051 - 1120
DSNIMLEQKAPVFPQQYASQAQMAQGSYSPMQDPNFHTMGQRPSYATLRMQPRPGLRPTGLVQNQPNQLR   1121 - 1190
LQLQHRLQAQQNRQPLMNQISNVSNVNLTLRPGVPTQAPINAQMLAQRQREILNQHLRQRQMHQQQQVQQ   1191 - 1260
RTLMMRGQGLNMTPSMVAPSGMPATMSNPRIPQANAQQFPFPPNYGISQQPDPGFTGATTPQSPLMSPRM   1261 - 1330
AHTQSPMMQQSQANPAYQAPSDINGWAQGNMGGNSMFSQQSPPHFGQQANTSMYSNNMNINVSMATNTGG   1331 - 1400
MSSMNQMTGQISMTSVTSVPTSGLSSMGPEQVNDPALRGGNLFPNQLPGMDMIKQEGDTTRKYC         1401 - 1464
//

Text Mined References (161)

PMID Year Title
26983699 2016 Production of unstable proteins through the formation of stable core complexes.
26970301 2016 Pterosin B has multiple targets in gluconeogenic programs, including coenzyme Q in ROR?-SRC2 signaling.
26898479 2016 SGT1 is required in PcINF1/SRC2-1 induced pepper defense response by interacting with SRC2-1.
26869487 2016 3, 3', 5-triiodo-L-thyronine Increases In Vitro Chondrogenesis of Mesenchymal Stem Cells From Human Umbilical Cord Stroma Through SRC2.
26799514 2016 NCOA2 is a candidate target gene of 8q gain associated with clinically aggressive prostate cancer.
26553876 2016 Unexpected Allosteric Network Contributes to LRH-1 Co-regulator Selectivity.
26438513 2015 ETV3-NCOA2 in indeterminate cell histiocytosis: clonal translocation supports sui generis.
26350169 2015 NcoA2-Dependent Inhibition of HIF-1? Activation Is Regulated via AhR.
26267537 2015 Characterization of a Steroid Receptor Coactivator Small Molecule Stimulator that Overstimulates Cancer Cells and Leads to Cell Stress and Death.
26261634 2015 Association of NCOA2 gene polymorphisms with obesity and dyslipidemia in the Chinese Han population.
More...