Property Summary

NCBI Gene PubMed Count 75
Grant Count 17
R01 Count 10
Funding $1,326,615.93
PubMed Score 31.84
PubTator Score 88.80

Knowledge Summary

Patent

No data available

Expression

Gene RIF (48)

PMID Text
26330748 Corneal fibroblasts demonstrate the expression of TGIF1 and TGIF2 transcription factors. These transcriptional repressors are critical, at least partially, in mediating the antifibrotic effect of vorinostat in the cornea.
26104768 our study demonstrated the oncogenic role of TGIF1 in NSCLC, and TGIF1 might be a therapeutic target for non-small cell lung cancer .
26091794 Our results suggested that elevated expression of TGIF was involved in lung carcinogenesis.
25841779 c-Src/AKT is the upstream signaling that regulates TGIF-induced Nox4 activation and subsequent superoxide production.
25791921 TG-interacting factor transcriptionally induced by AKT/FOXO3A is a negative regulator that antagonizes arsenic trioxide-induced cancer cell apoptosis.
25537191 we suggest that TGIF plays an important role in low-dose arsenic-induced malignant transformation of HaCaT cells, which is regulated by c-Src/EGFR/AKT/FOXO3A pathway and redox signaling.
25349154 TGIF1 has a role as a negative regulator of MLL-rearranged acute myeloid leukemia
24478032 TG-interacting factor 1 (Tgif1) is an important repressor of SOAT2 gene expression.
24215395 TGIF1 is a relevant candidate gene with potential to contribute in the genesis of high myopia.
24119525 Alternative splicing of TGIF1 is deregulated in OSCC, with overexpression of some splicing variants, especially TGIF1v8, which is associated with advanced stages of OSCC.
More...

AA Sequence

MVLAQSRVSAGVGSPHCSGSGGGGSDSFPWPASHPGNPQCSFSTAFLASPRLSRGTLAYLPPAPWSSLAT      1 - 70
PSALLGSSCAPPPPPARCPQPRALSPELGTKAGPRRPHRWELPRSPSQGAQGPAPRRRLLETMKGIVAAS     71 - 140
GSETEDEDSMDIPLDLSSSAGSGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQ    141 - 210
VCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISETSSVESVMGIKNFMPALEETPFHSCTAGPNPT    211 - 280
LGRPLSPKPSSPGSVLARPSVICHTTVTALKDVPFSLCQSVGVGQNTDIQQIAAKNFTDTSLMYPEDTCK    281 - 350
SGPSTNTQSGLFNTPPPTPPDLNQDFSGFQLLVDVALKRAAEMELQAKLTA                       351 - 401
//

Text Mined References (76)

PMID Year Title
26330748 2015 Role of 5'TG3'-interacting factors (TGIFs) in Vorinostat (HDAC inhibitor)-mediated Corneal Fibrosis Inhibition.
26104768 2015 TGIF1 promoted the growth and migration of cancer cells in nonsmall cell lung cancer.
26091794 2015 Elevated expression of TGIF is involved in lung carcinogenesis.
25873176 2015 TGIF governs a feed-forward network that empowers Wnt signaling to drive mammary tumorigenesis.
25841779 2015 Transforming growth factor ?-interacting factor-induced malignant progression of hepatocellular carcinoma cells depends on superoxide production from Nox4.
25791921 2015 TG-interacting factor transcriptionally induced by AKT/FOXO3A is a negative regulator that antagonizes arsenic trioxide-induced cancer cell apoptosis.
25537191 2015 TG-interacting factor mediates arsenic-induced malignant transformation of keratinocytes via c-Src/EGFR/AKT/FOXO3A and redox signalings.
25416956 2014 A proteome-scale map of the human interactome network.
25349154 2015 TGIF1 is a negative regulator of MLL-rearranged acute myeloid leukemia.
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
More...