Property Summary

NCBI Gene PubMed Count 79
PubMed Score 34.04
PubTator Score 88.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute quadriplegic myopathy 1.380 1.1e-07
adult high grade glioma 1.600 2.5e-03
astrocytoma 1.400 6.8e-12
Astrocytoma, Pilocytic 1.300 3.3e-04
atypical teratoid / rhabdoid tumor 2.800 3.2e-08
Breast cancer 2.900 2.7e-02
ependymoma 2.200 2.9e-02
glioblastoma 2.100 1.0e-07
group 3 medulloblastoma 1.800 6.1e-03
intraductal papillary-mucinous carcinoma... 1.100 2.5e-03
intraductal papillary-mucinous neoplasm ... 1.200 1.1e-02
lung adenocarcinoma 1.100 6.5e-04
lung cancer 1.500 4.1e-03
ovarian cancer 2.000 4.3e-05
pancreatic cancer 1.200 9.7e-06
pancreatic ductal adenocarcinoma liver m... 1.489 2.8e-02
pituitary cancer -2.500 3.7e-06
primitive neuroectodermal tumor 2.200 5.8e-05
psoriasis -1.100 2.0e-09
tuberculosis -2.200 1.0e-07

 OMIM Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (52)

AA Sequence

MVLAQSRVSAGVGSPHCSGSGGGGSDSFPWPASHPGNPQCSFSTAFLASPRLSRGTLAYLPPAPWSSLAT      1 - 70
PSALLGSSCAPPPPPARCPQPRALSPELGTKAGPRRPHRWELPRSPSQGAQGPAPRRRLLETMKGIVAAS     71 - 140
GSETEDEDSMDIPLDLSSSAGSGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQ    141 - 210
VCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISETSSVESVMGIKNFMPALEETPFHSCTAGPNPT    211 - 280
LGRPLSPKPSSPGSVLARPSVICHTTVTALKDVPFSLCQSVGVGQNTDIQQIAAKNFTDTSLMYPEDTCK    281 - 350
SGPSTNTQSGLFNTPPPTPPDLNQDFSGFQLLVDVALKRAAEMELQAKLTA                       351 - 401
//

Text Mined References (80)

PMID Year Title