Property Summary

NCBI Gene PubMed Count 19
Grant Count 53
R01 Count 46
Funding $10,066,415.73
PubMed Score 5.39
PubTator Score 81.94

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (2)

PMID Text
19246067 The authors demonstrate the interaction of both RNA polymerase I and III with hepatitis delta virus RNA, both in vitro and in human cells.
15113842 This study identifies the first nuclear import sequence within the TBP-Associated Factor subunits of Selectivity Factor 1.

AA Sequence

MSDFSEELKGPVTDDEEVETSVLSGAGMHFPWLQTYVETVAIGGKRRKDFAQTTSACLSFIQEALLKHQW      1 - 70
QQAAEYMYSYFQTLEDSDSYKRQAAPEIIWKLGSEILFYHPKSNMESFNTFANRMKNIGVMNYLKISLQH     71 - 140
ALYLLHHGMLKDAKRNLSEAETWRHGENTSSREILINLIQAYKGLLQYYTWSEKKMELSKLDKDDYAYNA    141 - 210
VAQDVFNHSWKTSANISALIKIPGVWDPFVKSYVEMLEFYGDRDGAQEVLTNYAYDEKFPSNPNAHIYLY    211 - 280
NFLKRQKAPRSKLISVLKILYQIVPSHKLMLEFHTLLRKSEKEEHRKLGLEVLFGVLDFAGCTKNITAWK    281 - 350
YLAKYLKNILMGNHLAWVQEEWNSRKNWWPGFHFSYFWAKSDWKEDTALACEKAFVAGLLLGKGCRYFRY    351 - 420
ILKQDHQILGKKIKRMKRSVKKYSIVNPRL                                            421 - 450
//

Text Mined References (21)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
20075868 2010 Nucleolar retention of a translational C/EBPalpha isoform stimulates rDNA transcription and cell size.
19246067 2009 The hepatitis delta virus RNA genome interacts with the human RNA polymerases I and III.
17318177 2007 A novel TBP-associated factor of SL1 functions in RNA polymerase I transcription.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15970593 2005 TBP-TAF complex SL1 directs RNA polymerase I pre-initiation complex formation and stabilizes upstream binding factor at the rDNA promoter.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15226435 2004 Multiple protein-protein interactions by RNA polymerase I-associated factor PAF49 and role of PAF49 in rRNA transcription.
15113842 2004 The carboxyl-terminus directs TAF(I)48 to the nucleus and nucleolus and associates with multiple nuclear import receptors.
More...