Property Summary

NCBI Gene PubMed Count 19
PubMed Score 6.46
PubTator Score 81.94

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (2)

AA Sequence

MSDFSEELKGPVTDDEEVETSVLSGAGMHFPWLQTYVETVAIGGKRRKDFAQTTSACLSFIQEALLKHQW      1 - 70
QQAAEYMYSYFQTLEDSDSYKRQAAPEIIWKLGSEILFYHPKSNMESFNTFANRMKNIGVMNYLKISLQH     71 - 140
ALYLLHHGMLKDAKRNLSEAETWRHGENTSSREILINLIQAYKGLLQYYTWSEKKMELSKLDKDDYAYNA    141 - 210
VAQDVFNHSWKTSANISALIKIPGVWDPFVKSYVEMLEFYGDRDGAQEVLTNYAYDEKFPSNPNAHIYLY    211 - 280
NFLKRQKAPRSKLISVLKILYQIVPSHKLMLEFHTLLRKSEKEEHRKLGLEVLFGVLDFAGCTKNITAWK    281 - 350
YLAKYLKNILMGNHLAWVQEEWNSRKNWWPGFHFSYFWAKSDWKEDTALACEKAFVAGLLLGKGCRYFRY    351 - 420
ILKQDHQILGKKIKRMKRSVKKYSIVNPRL                                            421 - 450
//

Text Mined References (21)

PMID Year Title