Property Summary

NCBI Gene PubMed Count 19
PubMed Score 5.39
PubTator Score 81.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 5.10730601139618E-14
medulloblastoma 1524 2.15016336449227E-8
malignant mesothelioma 3163 6.54447040793269E-8
posterior fossa group A ependymoma 1511 7.63950345360933E-7
glioblastoma 5572 1.72137225150055E-6
pediatric high grade glioma 2712 6.47661717156722E-5
lung cancer 4473 1.03683544186217E-4
medulloblastoma, large-cell 6234 1.6893054847372E-4
atypical teratoid/rhabdoid tumor 1095 2.70760345408715E-4
primitive neuroectodermal tumor 3031 2.76750292573475E-4
ovarian cancer 8492 4.74911025665191E-4
nasopharyngeal carcinoma 1056 0.00107257848921103
tuberculosis and treatment for 3 months 327 0.00168404030182355
colon cancer 1475 0.00279344113346444
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00405346129346463
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00565857061536392
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0183389192488565
active Crohn's disease 918 0.0199453433426869
Disease Target Count Z-score Confidence
Galactosemia 20 3.406 1.7

Expression

Synonym

Accession Q15573 B2RDZ8 D3DTB7 Q9NWA1
Symbols SL1
RAFI48
TAFI48
MGC:17061

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GO Function (1)

Gene RIF (2)

PMID Text
19246067 The authors demonstrate the interaction of both RNA polymerase I and III with hepatitis delta virus RNA, both in vitro and in human cells.
15113842 This study identifies the first nuclear import sequence within the TBP-Associated Factor subunits of Selectivity Factor 1.

AA Sequence

MSDFSEELKGPVTDDEEVETSVLSGAGMHFPWLQTYVETVAIGGKRRKDFAQTTSACLSFIQEALLKHQW      1 - 70
QQAAEYMYSYFQTLEDSDSYKRQAAPEIIWKLGSEILFYHPKSNMESFNTFANRMKNIGVMNYLKISLQH     71 - 140
ALYLLHHGMLKDAKRNLSEAETWRHGENTSSREILINLIQAYKGLLQYYTWSEKKMELSKLDKDDYAYNA    141 - 210
VAQDVFNHSWKTSANISALIKIPGVWDPFVKSYVEMLEFYGDRDGAQEVLTNYAYDEKFPSNPNAHIYLY    211 - 280
NFLKRQKAPRSKLISVLKILYQIVPSHKLMLEFHTLLRKSEKEEHRKLGLEVLFGVLDFAGCTKNITAWK    281 - 350
YLAKYLKNILMGNHLAWVQEEWNSRKNWWPGFHFSYFWAKSDWKEDTALACEKAFVAGLLLGKGCRYFRY    351 - 420
ILKQDHQILGKKIKRMKRSVKKYSIVNPRL                                            421 - 450
//

Text Mined References (21)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
20075868 2010 Nucleolar retention of a translational C/EBPalpha isoform stimulates rDNA transcription and cell size.
19246067 2009 The hepatitis delta virus RNA genome interacts with the human RNA polymerases I and III.
17318177 2007 A novel TBP-associated factor of SL1 functions in RNA polymerase I transcription.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15970593 2005 TBP-TAF complex SL1 directs RNA polymerase I pre-initiation complex formation and stabilizes upstream binding factor at the rDNA promoter.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15226435 2004 Multiple protein-protein interactions by RNA polymerase I-associated factor PAF49 and role of PAF49 in rRNA transcription.
15113842 2004 The carboxyl-terminus directs TAF(I)48 to the nucleus and nucleolus and associates with multiple nuclear import receptors.
More...