Property Summary

NCBI Gene PubMed Count 12
PubMed Score 17.23
PubTator Score 8.87

Knowledge Summary

Patent (1,036)

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 2.5e-06
medulloblastoma, large-cell 6241 8.3e-04
fibroadenoma 559 4.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Wilson-Turner syndrome 14 3.504 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
fibroadenoma -1.200 4.5e-02
medulloblastoma, large-cell -1.300 8.3e-04
ovarian cancer 1.200 2.5e-06

Gene RIF (4)

AA Sequence

MAGERPPLRGPGPGPGEVPGEGPPGPGGTGGGPGRGRPSSYRALRSAVSSLARVDDFHCAEKIGAGFFSE      1 - 70
VYKVRHRQSGQVMVLKMNKLPSNRGNTLREVQLMNRLRHPNILRFMGVCVHQGQLHALTEYMNGGTLEQL     71 - 140
LSSPEPLSWPVRLHLALDIARGLRYLHSKGVFHRDLTSKNCLVRREDRGFTAVVGDFGLAEKIPVYREGA    141 - 210
RKEPLAVVGSPYWMAPEVLRGELYDEKADVFAFGIVLCELIARVPADPDYLPRTEDFGLDVPAFRTLVGD    211 - 280
DCPLPFLLLAIHCCNLEPSTRAPFTEITQHLEWILEQLPEPAPLTRTALTHNQGSVARGGPSATLPRPDP    281 - 350
RLSRSRSDLFLPPSPESPPNWGDNLTRVNPFSLREDLRGGKIKLLDTPSKPVLPLVPPSPFPSTQLPLVT    351 - 420
TPETLVQPGTPARRCRSLPSSPELPRRMETALPGPGPPAVGPSAEEKMECEGSSPEPEPPGPAPQLPLAV    421 - 490
ATDNFISTCSSASQPWSPRSGPVLNNNPPAVVVNSPQGWAGEPWNRAQHSLPRAAALERTEPSPPPSAPR    491 - 560
EPDEGLPCPGCCLGPFSFGFLSMCPRPTPAVARYRNLNCEAGSLLCHRGHHAKPPTPSLQLPGARS        561 - 626
//

Text Mined References (16)

PMID Year Title