Property Summary

NCBI Gene PubMed Count 12
PubMed Score 16.61
PubTator Score 8.87

Knowledge Summary

Patent (1,036)

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell -1.300 0.001
fibroadenoma -1.200 0.045
ovarian cancer 1.200 0.000

Synonym

Accession Q15569 Q8IXZ8
Symbols

Gene

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (4)

PMID Text
25849865 Actin remodelling factor TESK1 is a key player in the ciliogenesis control network in which YAP/TAZ and directional vesicle trafficking are integral components.
20237496 Observational study of gene-disease association. (HuGE Navigator)
18216281 enhanced TESK1 activity results in increased stress fibers (via phospho-cofilin), but this can be blocked by elevating Spred1
15817463 the association between actopaxin and TESK1, which is likely regulated by phosphorylation of actopaxin, regulates TESK1 activity and subsequent cellular spreading on fibronectin

AA Sequence

MAGERPPLRGPGPGPGEVPGEGPPGPGGTGGGPGRGRPSSYRALRSAVSSLARVDDFHCAEKIGAGFFSE      1 - 70
VYKVRHRQSGQVMVLKMNKLPSNRGNTLREVQLMNRLRHPNILRFMGVCVHQGQLHALTEYMNGGTLEQL     71 - 140
LSSPEPLSWPVRLHLALDIARGLRYLHSKGVFHRDLTSKNCLVRREDRGFTAVVGDFGLAEKIPVYREGA    141 - 210
RKEPLAVVGSPYWMAPEVLRGELYDEKADVFAFGIVLCELIARVPADPDYLPRTEDFGLDVPAFRTLVGD    211 - 280
DCPLPFLLLAIHCCNLEPSTRAPFTEITQHLEWILEQLPEPAPLTRTALTHNQGSVARGGPSATLPRPDP    281 - 350
RLSRSRSDLFLPPSPESPPNWGDNLTRVNPFSLREDLRGGKIKLLDTPSKPVLPLVPPSPFPSTQLPLVT    351 - 420
TPETLVQPGTPARRCRSLPSSPELPRRMETALPGPGPPAVGPSAEEKMECEGSSPEPEPPGPAPQLPLAV    421 - 490
ATDNFISTCSSASQPWSPRSGPVLNNNPPAVVVNSPQGWAGEPWNRAQHSLPRAAALERTEPSPPPSAPR    491 - 560
EPDEGLPCPGCCLGPFSFGFLSMCPRPTPAVARYRNLNCEAGSLLCHRGHHAKPPTPSLQLPGARS        561 - 626
//

Text Mined References (16)

PMID Year Title
25849865 2015 Actin remodelling factors control ciliogenesis by regulating YAP/TAZ activity and vesicle trafficking.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
18216281 2008 Spred1 and TESK1--two new interaction partners of the kinase MARKK/TAO1 that link the microtubule and actin cytoskeleton.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15817463 2005 Actopaxin interacts with TESK1 to regulate cell spreading on fibronectin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12027893 2002 Human sprouty 4, a new ras antagonist on 5q31, interacts with the dual specificity kinase TESK1.
More...