Property Summary

NCBI Gene PubMed Count 13
PubMed Score 25.96
PubTator Score 35.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Polycystic ovary syndrome -1.036 7.3e-03
adult high grade glioma -1.400 1.4e-03
atypical teratoid / rhabdoid tumor 2.200 3.1e-08
chronic lymphosyte leukemia 1.600 2.6e-13
ependymoma 1.300 3.7e-02
glioblastoma 1.100 1.3e-02
group 3 medulloblastoma 1.300 2.2e-04
intraductal papillary-mucinous carcinoma... -1.100 7.8e-03
lung carcinoma -1.100 1.2e-13
medulloblastoma, large-cell 1.500 3.7e-04
osteosarcoma 1.584 1.2e-02
ovarian cancer 1.600 4.5e-06
primitive neuroectodermal tumor 1.500 8.9e-03

Protein-protein Interaction (7)

Gene RIF (4)

AA Sequence

MGEPRAGAALDDGSGWTGSEEGSEEGTGGSEGAGGDGGPDAEGVWSPDIEQSFQEALAIYPPCGRRKIIL      1 - 70
SDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSREIQSKLKDQVSKDKAFQTMATMSSAQL     71 - 140
ISAPSLQAKLGPTGPQASELFQFWSGGSGPPWNVPDVKPFSQTPFTLSLTPPSTDLPGYEPPQALSPLPP    141 - 210
PTPSPPAWQARGLGTARLQLVEFSAFVEPPDAVDSYQRHLFVHISQHCPSPGAPPLESVDVRQIYDKFPE    211 - 280
KKGGLRELYDRGPPHAFFLVKFWADLNWGPSGEEAGAGGSISSGGFYGVSSQYESLEHMTLTCSSKVCSF    281 - 350
GKQVVEKVETERAQLEDGRFVYRLLRSPMCEYLVNFLHKLRQLPERYMMNSVLENFTILQVVTNRDTQEL    351 - 420
LLCTAYVFEVSTSERGAQHHIYRLVRD                                               421 - 447
//

Text Mined References (14)

PMID Year Title