Property Summary

NCBI Gene PubMed Count 12
Grant Count 16
Funding $3,049,385.12
PubMed Score 126.60
PubTator Score 35.10

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
25995450 TAZ negatively regulate transcription of DeltaNp63 through TEAD1,2,3 and 4 transcription factors.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20368466 structural and functional analysis of the YAP-binding domain of human TEAD2
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGEPRAGAALDDGSGWTGSEEGSEEGTGGSEGAGGDGGPDAEGVWSPDIEQSFQEALAIYPPCGRRKIIL      1 - 70
SDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSREIQSKLKDQVSKDKAFQTMATMSSAQL     71 - 140
ISAPSLQAKLGPTGPQASELFQFWSGGSGPPWNVPDVKPFSQTPFTLSLTPPSTDLPGYEPPQALSPLPP    141 - 210
PTPSPPAWQARGLGTARLQLVEFSAFVEPPDAVDSYQRHLFVHISQHCPSPGAPPLESVDVRQIYDKFPE    211 - 280
KKGGLRELYDRGPPHAFFLVKFWADLNWGPSGEEAGAGGSISSGGFYGVSSQYESLEHMTLTCSSKVCSF    281 - 350
GKQVVEKVETERAQLEDGRFVYRLLRSPMCEYLVNFLHKLRQLPERYMMNSVLENFTILQVVTNRDTQEL    351 - 420
LLCTAYVFEVSTSERGAQHHIYRLVRD                                               421 - 447
//

Text Mined References (13)

PMID Year Title
25995450 2015 Hippo Component TAZ Functions as a Co-repressor and Negatively Regulates ?Np63 Transcription through TEA Domain (TEAD) Transcription Factor.
25416956 2014 A proteome-scale map of the human interactome network.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20368466 2010 Structural and functional analysis of the YAP-binding domain of human TEAD2.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19324877 2009 TEAD transcription factors mediate the function of TAZ in cell growth and epithelial-mesenchymal transition.
18579750 2008 TEAD mediates YAP-dependent gene induction and growth control.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...