Property Summary

NCBI Gene PubMed Count 39
Grant Count 29
R01 Count 16
Funding $4,564,513.41
PubMed Score 39.54
PubTator Score 26.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Gene RIF (25)

PMID Text
26832411 Tead4 cooperates with AP1 transcription factors to coordinate target gene transcription.
26487755 TEAD4 overexpression induced p16 in HAoSMCs homozygous for the nonrisk coronary disease allele, but not for the risk allele.
26041389 potential anti-oxidation gene and can prevent H2O2-induced endothelial cell oxidative damage by activating Klotho
25995450 TAZ negatively regulate transcription of DeltaNp63 through TEAD1,2,3 and 4 transcription factors.
25970772 TEAD4 and KLF5, in collaboration, promoted triple negative breast cancer cell proliferation and tumor growth in part by inhibiting p27 gene transcription
25687649 the peptides TEF3-11-66 and TEF3-1197-434 functioned as two independent activation domains, suggesting that N-terminal domain of TEF3-1 also has transcriptional activation capacity
25628125 Our findings suggest that genetic variants of Hippo pathway genes, particularly YAP1 rs11225163, TEAD1 rs7944031 and TEAD4 rs1990330, may independently or jointly modulate survival of CM patients.
24520353 Edg-1 is a potential target gene of RTEF-1 and is involved in RTEF-1-induced angiogenesis in endothelial cells.
24325916 the multilevel perturbations of TEAD4 at epigenetic, transcriptional and posttranslational levels may contribute to GC development.
23780915 convergent optimization of the YAP/TAZ TEAD binding site suggests that the similarity in the affinities of binding of YAP to TEAD and of TAZ to TEAD is important for Hippo pathway functionality.
More...

AA Sequence

MEGTAGTITSNEWSSPTSPEGSTASGGSQALDKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSD      1 - 70
EGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIIS     71 - 140
ATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPP    141 - 210
APPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGG    211 - 280
LKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYA    281 - 350
RYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSAS    351 - 420
EHGAQHHIYRLVKE                                                            421 - 434
//

Text Mined References (43)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26832411 2016 Tead and AP1 Coordinate Transcription and Motility.
26487755 2015 9p21.3 Coronary Artery Disease Risk Variants Disrupt TEAD Transcription Factor-Dependent Transforming Growth Factor ? Regulation of p16 Expression in Human Aortic Smooth Muscle Cells.
26041389 2015 RTEF-1 protects against oxidative damage induced by H2O2 in human umbilical vein endothelial cells through Klotho activation.
25995450 2015 Hippo Component TAZ Functions as a Co-repressor and Negatively Regulates ?Np63 Transcription through TEA Domain (TEAD) Transcription Factor.
25970772 2015 The interplay between TEAD4 and KLF5 promotes breast cancer partially through inhibiting the transcription of p27Kip1.
25687649 2015 Characterization of the transcriptional activation domains of human TEF3-1 (transcription enhancer factor 3 isoform 1).
25628125 2015 Genetic variants in Hippo pathway genes YAP1, TEAD1 and TEAD4 are associated with melanoma-specific survival.
24525233 2014 A peptide mimicking VGLL4 function acts as a YAP antagonist therapy against gastric cancer.
24520353 2014 Endothelial differentiation gene-1, a new downstream gene is involved in RTEF-1 induced angiogenesis in endothelial cells.
More...