Property Summary

NCBI Gene PubMed Count 43
PubMed Score 63.79
PubTator Score 38.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -2.000 0.000
osteosarcoma 1.145 0.001
ependymoma -2.500 0.000
glioblastoma -2.600 0.000
sonic hedgehog group medulloblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -3.000 0.000
medulloblastoma, large-cell -2.300 0.000
primitive neuroectodermal tumor -1.500 0.005
colon cancer -1.400 0.000
pediatric high grade glioma -2.300 0.000
pilocytic astrocytoma -1.700 0.000
subependymal giant cell astrocytoma -1.193 0.009
ovarian cancer -1.800 0.000
pituitary cancer 1.300 0.000

Gene RIF (15)

PMID Text
27030108 Aurora B and CDK1 temporally regulate the binding affinity of EB2 for microtubules, thereby ensuring kinetochore microtubule dynamics, proper mitotic progression and genome stability.
26637975 Mutations in either TUBB or MAPRE2 cause circumferential skin creases Kunze type.
23813963 EB2 is evidently important for initial microtubule reorganisation during epithelial polarisation, whereas its downregulation facilitates EB1 and ACF7 microtubule lattice association, microtubule-actin filament co-alignment and bundle formation.
22424550 results suggest that EB1 and ClipCG12 act cooperatively to regulate microtubule dynamics (EB1)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20008324 heterodimer formation between EB1 and EB3, but not between EB2 and the other two EBs, occurs both in vitro and in cells as revealed by live cell imaging
19787265 MAPRE2 is highly expressed in pancreatic cancer cells, and seems to be involved in perineural invasion
19778897 EB1-tubulin interactions are mediated in part by the same tubulin acidic tails utilized by other MAPs
18081319 p150Glued may activate and thereby facilitate the recruitment of EB1 to the tips of microtubules to regulate their dynamics.
17889670 Crystal structures of the tubulin binding domains of XMAP215 (yeast Stu2p and Drosophila Msps), EB1 (yeast Bim1p and human EB1), and CLIP-170 (human), which reveal diverse tubulin binding interfaces, are reported.
More...

AA Sequence

MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHDIIAWVNDI      1 - 70
VSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLV     71 - 140
KGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSP    141 - 210
AAKPGSTPSRPSSAKRASSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQ    211 - 280
EHGQENDDLVQRLMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEY                           281 - 327
//

Text Mined References (52)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27030108 2016 Phosphorylation of EB2 by Aurora B and CDK1 ensures mitotic progression and genome stability.
26637975 2015 Mutations in Either TUBB or MAPRE2 Cause Circumferential Skin Creases Kunze Type.
25416956 2014 A proteome-scale map of the human interactome network.
23813963 2013 The microtubule end-binding protein EB2 is a central regulator of microtubule reorganisation in apico-basal epithelial differentiation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22424550 2012 Cooperative stabilization of microtubule dynamics by EB1 and CLIP-170 involves displacement of stably bound P(i) at microtubule ends.
22216133 2011 EB1 is required for spindle symmetry in mammalian mitosis.
More...