Property Summary

NCBI Gene PubMed Count 43
PubMed Score 69.05
PubTator Score 38.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.200 4.9e-07
Astrocytoma, Pilocytic -1.700 3.0e-10
atypical teratoid / rhabdoid tumor -1.200 3.9e-04
colon cancer -1.400 3.4e-04
ependymoma -1.200 3.0e-12
glioblastoma -2.000 1.8e-09
malignant mesothelioma -2.000 2.3e-06
medulloblastoma -1.100 2.0e-04
medulloblastoma, large-cell -2.300 8.3e-07
osteosarcoma 1.145 9.6e-04
ovarian cancer -1.800 6.3e-11
pituitary cancer 1.300 2.9e-04
primitive neuroectodermal tumor -1.500 4.9e-03
subependymal giant cell astrocytoma -1.193 8.6e-03

Gene RIF (15)

AA Sequence

MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHDIIAWVNDI      1 - 70
VSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLV     71 - 140
KGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSP    141 - 210
AAKPGSTPSRPSSAKRASSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQ    211 - 280
EHGQENDDLVQRLMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEY                           281 - 327
//

Text Mined References (53)

PMID Year Title