Property Summary

NCBI Gene PubMed Count 43
Grant Count 37
R01 Count 10
Funding $2,387,155.52
PubMed Score 12.59
PubTator Score 22.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.283 0.025
Multiple myeloma 1.935 0.001
ovarian cancer 1.600 0.004

Gene RIF (20)

PMID Text
25575120 the MED26-NTD functions as a molecular switch in the exchange of TBP-associated factor 7 (TAF7) for LEC to facilitate the transition from initiation to elongation during transcription of a subset of snRNA genes
25412659 These results resolve the structural organization of the TAF1-TAF7 module in TFIID and unveil a critical promoter-binding function of TAF1 in transcription regulation.
24927529 the surface of the TAF1-TAF7 complex contains two prominent conserved surface pockets, one of which binds selectively to an inhibitory trimethylated histone H3
23027873 three CTD kinases, CDK7, CDK9, and BRD4, engage in cross-talk, modulating their subsequent C-terminal domain phosphorylation, and also phosphorylate TAF7
22711989 analysis of phosphorylation-dependent regulation of cyclin D1 and cyclin A gene transcription by TFIID subunits TAF1 and TAF7
20937824 TAF7, until now considered only a TFIID component and regulator of TAF1-dependent transcription, also regulates TAF1-independent transcription
18391197 TAF7 interacts with the transcription factors, TFIIH and P-TEFb, resulting in the inhibition of their Pol II CTD kinase activities
17320040 These results suggest normal TBP-binding interactions--specifically recognition, stability, and conformation-are disrupted by CldAMP insertion into eukaryotic promoter sequences.
16407123 Functions as a check-point regulator suppressing premature transcription initiation until preinitiation complex assembly is complete.
15078871 TAF7 has a role as a basal regulator for mammalian polyamine transport activity and MGBG-induced apoptosis
More...

AA Sequence

MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDL      1 - 70
PCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPL     71 - 140
KNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQG    141 - 210
HDSLEHDELREIFNDLSSSSEDEDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMG    211 - 280
IQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK     281 - 349
//

Text Mined References (53)

PMID Year Title
27007846 2016 Structure of promoter-bound TFIID and model of human pre-initiation complex assembly.
25575120 2015 MED26 regulates the transcription of snRNA genes through the recruitment of little elongation complex.
25412659 2014 Crystal structure of a TAF1-TAF7 complex in human transcription factor IID reveals a promoter binding module.
24927529 2014 Structural and functional insight into TAF1-TAF7, a subcomplex of transcription factor II D.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24036077 2013 Transcriptional coactivator CIITA, a functional homolog of TAF1, has kinase activity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23027873 2012 Cross-talk among RNA polymerase II kinases modulates C-terminal domain phosphorylation.
22711989 2012 Phosphorylation-dependent regulation of cyclin D1 and cyclin A gene transcription by TFIID subunits TAF1 and TAF7.
22424883 2012 Genome-wide association study of lung function decline in adults with and without asthma.
More...