Property Summary

NCBI Gene PubMed Count 44
PubMed Score 13.40
PubTator Score 22.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
ovarian cancer 8520 1.2e-05
Multiple myeloma 1332 5.4e-04
Waldenstrons macroglobulinemia 765 2.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Asthma 385 0.0 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.935 5.4e-04
ovarian cancer -1.400 1.2e-05
Waldenstrons macroglobulinemia 1.283 2.5e-02

Gene RIF (21)

AA Sequence

MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDL      1 - 70
PCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPL     71 - 140
KNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQG    141 - 210
HDSLEHDELREIFNDLSSSSEDEDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMG    211 - 280
IQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK     281 - 349
//

Text Mined References (55)

PMID Year Title