Property Summary

NCBI Gene PubMed Count 43
PubMed Score 12.59
PubTator Score 22.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
Multiple myeloma 1328 5.40654436846613E-4
ovarian cancer 8492 0.00442557491695755
Waldenstrons macroglobulinemia 765 0.0246801451694291
Disease Target Count Z-score Confidence
Asthma 349 0.0 1.0
Disease Target Count Z-score Confidence
Epidermodysplasia verruciformis 21 3.974 2.0
Trophoblastic neoplasm 1 3.153 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.283 0.025
Multiple myeloma 1.935 0.001
ovarian cancer 1.600 0.004

Synonym

Accession Q15545 B2RBV9 Q13036
Symbols TAF2F
TAFII55

Gene

PANTHER Protein Class (1)

PDB

5FUR   4RGW  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

Gene RIF (20)

PMID Text
25575120 the MED26-NTD functions as a molecular switch in the exchange of TBP-associated factor 7 (TAF7) for LEC to facilitate the transition from initiation to elongation during transcription of a subset of snRNA genes
25412659 These results resolve the structural organization of the TAF1-TAF7 module in TFIID and unveil a critical promoter-binding function of TAF1 in transcription regulation.
24927529 the surface of the TAF1-TAF7 complex contains two prominent conserved surface pockets, one of which binds selectively to an inhibitory trimethylated histone H3
23027873 three CTD kinases, CDK7, CDK9, and BRD4, engage in cross-talk, modulating their subsequent C-terminal domain phosphorylation, and also phosphorylate TAF7
22711989 analysis of phosphorylation-dependent regulation of cyclin D1 and cyclin A gene transcription by TFIID subunits TAF1 and TAF7
20937824 TAF7, until now considered only a TFIID component and regulator of TAF1-dependent transcription, also regulates TAF1-independent transcription
18391197 TAF7 interacts with the transcription factors, TFIIH and P-TEFb, resulting in the inhibition of their Pol II CTD kinase activities
17320040 These results suggest normal TBP-binding interactions--specifically recognition, stability, and conformation-are disrupted by CldAMP insertion into eukaryotic promoter sequences.
16407123 Functions as a check-point regulator suppressing premature transcription initiation until preinitiation complex assembly is complete.
15078871 TAF7 has a role as a basal regulator for mammalian polyamine transport activity and MGBG-induced apoptosis
More...

AA Sequence

MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDL      1 - 70
PCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPL     71 - 140
KNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQG    141 - 210
HDSLEHDELREIFNDLSSSSEDEDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMG    211 - 280
IQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK     281 - 349
//

Text Mined References (53)

PMID Year Title
27007846 2016 Structure of promoter-bound TFIID and model of human pre-initiation complex assembly.
25575120 2015 MED26 regulates the transcription of snRNA genes through the recruitment of little elongation complex.
25412659 2014 Crystal structure of a TAF1-TAF7 complex in human transcription factor IID reveals a promoter binding module.
24927529 2014 Structural and functional insight into TAF1-TAF7, a subcomplex of transcription factor II D.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24036077 2013 Transcriptional coactivator CIITA, a functional homolog of TAF1, has kinase activity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23027873 2012 Cross-talk among RNA polymerase II kinases modulates C-terminal domain phosphorylation.
22711989 2012 Phosphorylation-dependent regulation of cyclin D1 and cyclin A gene transcription by TFIID subunits TAF1 and TAF7.
22424883 2012 Genome-wide association study of lung function decline in adults with and without asthma.
More...