Property Summary

NCBI Gene PubMed Count 31
PubMed Score 7.10
PubTator Score 10.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer 2.800 3.7e-02
group 3 medulloblastoma 1.300 1.5e-02
juvenile dermatomyositis 1.004 1.6e-09
osteosarcoma 1.292 1.4e-03
ovarian cancer 1.300 3.8e-05
Waldenstrons macroglobulinemia 1.036 2.1e-02

Gene RIF (9)

AA Sequence

MDDAHESPSDKGGETGESDETAAVPGDPGATDTDGIPEETDGDADVDLKEAAAEEGELESQDVSDLTTVE      1 - 70
REDSSLLNPAAKKLKIDTKEKKEKKQKVDEDEIQKMQILVSSFSEEQLNRYEMYRRSAFPKAAIKRLIQS     71 - 140
ITGTSVSQNVVIAMSGISKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIF    141 - 210
F//

Text Mined References (34)

PMID Year Title