Property Summary

NCBI Gene PubMed Count 23
PubMed Score 7.11
PubTator Score 3.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (6)

Disease log2 FC p
active Crohn's disease 1.085 1.8e-02
Breast cancer 2.800 2.7e-02
cystic fibrosis 1.700 3.0e-04
osteosarcoma 2.036 7.2e-04
pancreatic ductal adenocarcinoma liver m... -1.735 4.1e-02
pituitary cancer -1.200 2.0e-03

Synonym

Accession Q15543 B2R5E5 Q5TYV6
Symbols MRT60
TAF2K
TAFII18
TAFII-18
TAF(II)18

Gene

PANTHER Protein Class (1)

PDB

1BH8   1BH9  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (10)

AA Sequence

MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTH      1 - 70
KAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS                     71 - 124
//

Text Mined References (24)

PMID Year Title