Property Summary

NCBI Gene PubMed Count 39
PubMed Score 9.03
PubTator Score 15.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
active ulcerative colitis -1.069 4.8e-02
group 3 medulloblastoma 1.700 5.4e-03
lung cancer 1.300 2.0e-02
malignant mesothelioma 2.900 1.1e-08
osteosarcoma -1.723 2.0e-04
subependymal giant cell astrocytoma -1.194 8.5e-03

Gene RIF (15)

AA Sequence

MAALAEEQTEVAVKLEPEGPPTLLPPQAGDGAGEGSGGTTNNGPNGGGGNVAASSSTGGDGGTPKPTVAV      1 - 70
SAAAPAGAAPVPAAAPDAGAPHDRQTLLAVLQFLRQSKLREAEEALRREAGLLEEAVAGSGAPGEVDSAG     71 - 140
AEVTSALLSRVTASAPGPAAPDPPGTGASGATVVSGSASGPAAPGKVGSVAVEDQPDVSAVLSAYNQQGD    141 - 210
PTMYEEYYSGLKHFIECSLDCHRAELSQLFYPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLR    211 - 280
VLSSLTKKEHMKGNETMLDFRTSKFVLRISRDSYQLLKRHLQEKQNNQIWNIVQEHLYIDIFDGMPRSKQ    281 - 350
QIDAMVGSLAGEAKREANKSKVFFGLLKEPEIEVPLDDEDEEGENEEGKPKKKKPKKDSIGSKSKKQDPN    351 - 420
APPQNRIPLPELKDSDKLDKIMNMKETTKRVRLGPDCLPSICFYTFLNAYQGLTAVDVTDDSSLIAGGFA    421 - 490
DSTVRVWSVTPKKLRSVKQASDLSLIDKESDDVLERIMDEKTASELKILYGHSGPVYGASFSPDRNYLLS    491 - 560
SSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADV    561 - 630
NCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGH    631 - 700
GLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQELLL    701 - 770
GTYMTKSTPVVHLHFTRRNLVLAAGAYSPQ                                            771 - 800
//

Text Mined References (43)

PMID Year Title