Property Summary

NCBI Gene PubMed Count 39
PubMed Score 9.03
PubTator Score 15.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
malignant mesothelioma 3163 1.09476474731528E-8
osteosarcoma 7933 1.18036112855126E-6
lung cancer 4473 0.00146420120518887
group 3 medulloblastoma 2254 0.00537499262986521
subependymal giant cell astrocytoma 2287 0.00852899769148861
active ulcerative colitis 477 0.0479696287905484

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 2.900 0.000
osteosarcoma -2.504 0.000
lung cancer 1.500 0.001
active ulcerative colitis -1.069 0.048
group 3 medulloblastoma 1.700 0.005
subependymal giant cell astrocytoma -1.194 0.009

Synonym

Accession Q15542 A8K5B4 B2RMR0 B7ZKJ6 Q53EM4 Q5SYD5 Q86UZ7 Q9Y4K5
Symbols TAF2D
TAFII100
TAFII-100
TAF(II)100

Gene

PDB

2NXP  

  Ortholog (17)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly OMA Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (15)

PMID Text
24489103 results show that nonproductive binding of OGG1 to 8-oxoG in promoter sequences could be an epigenetic mechanism to modulate gene expression for a prompt innate immune response.
23827503 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
22834489 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
22696218 TFIID TAF6-TAF9 complex formation involves the HEAT repeat-containing C-terminal domain of TAF6 and is modulated by TAF5 protein.
17227857 TAF5 protein demonstrates the ability of the N-terminal half of the TAF5 gene to form a flexible, extended dimer, a key property required for the assembly of the TFIID complex
15637059 reversible SUMO modification at hsTAF5 contributes to the dynamic regulation of TFIID promoter-binding activity in human cells
9054383 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
8849451 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
8764062 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
8764009 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
More...

AA Sequence

MAALAEEQTEVAVKLEPEGPPTLLPPQAGDGAGEGSGGTTNNGPNGGGGNVAASSSTGGDGGTPKPTVAV      1 - 70
SAAAPAGAAPVPAAAPDAGAPHDRQTLLAVLQFLRQSKLREAEEALRREAGLLEEAVAGSGAPGEVDSAG     71 - 140
AEVTSALLSRVTASAPGPAAPDPPGTGASGATVVSGSASGPAAPGKVGSVAVEDQPDVSAVLSAYNQQGD    141 - 210
PTMYEEYYSGLKHFIECSLDCHRAELSQLFYPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLR    211 - 280
VLSSLTKKEHMKGNETMLDFRTSKFVLRISRDSYQLLKRHLQEKQNNQIWNIVQEHLYIDIFDGMPRSKQ    281 - 350
QIDAMVGSLAGEAKREANKSKVFFGLLKEPEIEVPLDDEDEEGENEEGKPKKKKPKKDSIGSKSKKQDPN    351 - 420
APPQNRIPLPELKDSDKLDKIMNMKETTKRVRLGPDCLPSICFYTFLNAYQGLTAVDVTDDSSLIAGGFA    421 - 490
DSTVRVWSVTPKKLRSVKQASDLSLIDKESDDVLERIMDEKTASELKILYGHSGPVYGASFSPDRNYLLS    491 - 560
SSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADV    561 - 630
NCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGH    631 - 700
GLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQELLL    701 - 770
GTYMTKSTPVVHLHFTRRNLVLAAGAYSPQ                                            771 - 800
//

Text Mined References (43)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24489103 2014 8-oxoguanine DNA glycosylase-1 augments proinflammatory gene expression by facilitating the recruitment of site-specific transcription factors.
24289924 2014 Phosphorylation of p53 by TAF1 inactivates p53-dependent transcription in the DNA damage response.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23292512 2013 The architecture of human general transcription factor TFIID core complex.
22696218 2012 TFIID TAF6-TAF9 complex formation involves the HEAT repeat-containing C-terminal domain of TAF6 and is modulated by TAF5 protein.
21269460 2011 Initial characterization of the human central proteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17996705 2007 An acetylation switch in p53 mediates holo-TFIID recruitment.
17227857 2007 Structural analysis and dimerization potential of the human TAF5 subunit of TFIID.
More...