Property Summary

NCBI Gene PubMed Count 57
PubMed Score 64.45
PubTator Score 48.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
aldosterone-producing adenoma -1.129 4.5e-02
astrocytic glioma 1.500 9.8e-03
Astrocytoma, Pilocytic 1.300 4.0e-06
atypical teratoid / rhabdoid tumor 1.500 1.0e-06
ependymoma 1.800 1.4e-02
glioblastoma 1.300 2.0e-06
group 4 medulloblastoma 1.400 3.1e-05
intraductal papillary-mucinous adenoma (... 1.300 5.3e-03
lung adenocarcinoma 1.218 5.8e-06
lung cancer 1.200 8.1e-03
medulloblastoma, large-cell 1.900 1.1e-05
non-small cell lung cancer 1.059 1.4e-10
oligodendroglioma 1.500 1.3e-02
osteosarcoma 1.544 2.7e-03
ovarian cancer 1.100 4.2e-07
pediatric high grade glioma 1.300 1.6e-05
primitive neuroectodermal tumor 1.300 9.7e-04
progressive supranuclear palsy -1.100 1.2e-02
psoriasis -2.600 2.6e-04
tuberculosis -1.100 4.8e-07

Gene RIF (38)

AA Sequence

MSVAFAAPRQRGKGEITPAAIQKMLDDNNHLIQCIMDSQNKGKTSECSQYQQMLHTNLVYLATIADSNQN      1 - 70
MQSLLPAPPTQNMPMGPGGMNQSGPPPPPRSHNMPSDGMVGGGPPAPHMQNQMNGQMPGPNHMPMQGPGP     71 - 140
NQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQPMGNYGPRPNMSMQPNQGPMMHQQP    141 - 210
PSQQYNMPQGGGQHYQGQQPPMGMMGQVNQGNHMMGQRQIPPYRPPQQGPPQQYSGQEDYYGDQYSHGGQ    211 - 280
GPPEGMNQQYYPDGHNDYGYQQPSYPEQGYDRPYEDSSQHYYEGGNSQYGQQQDAYQGPPPQQGYPPQQQ    281 - 350
QYPGQQGYPGQQQGYGPSQGGPGPQYPNYPQGQGQQYGGYRPTQPGPPQPPQQRPYGYDQGQYGNYQQ      351 - 418
//

Text Mined References (59)

PMID Year Title