Property Summary

NCBI Gene PubMed Count 54
Grant Count 1
Funding $865,000
PubMed Score 56.16
PubTator Score 48.28

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q15532 B0YJ95 Q16404 Q4VAX1 Q9BXC6
Symbols SYT
SSXT

Gene

 Grant Application (1)

Gene RIF (35)

PMID Text
25959879 a rare variant of the SS18-SSX1 fusion transcript, which could not be identified by routine procedures for genetic diagnosis, was detected. In addition, 8 missense mutations of cancer-related genes were confirmed
24922679 SYT gene split is associated with Synovial sarcoma.
24429587 Case Report: bronchial biphasic synovial sarcoma with SS18 gene rearrangement.
24166495 SS18-SSX-induced Wnt/beta-catenin signaling appears to be of crucial biological importance in synovial sarcoma tumorigenesis and progression.
24130893 These results suggest that the characteristic speckle localization pattern of SS18-SSX is strongly involved in the tumorigenesis through the SSX moiety of the SS18-SSX fusion protein.
24022186 SS18-SSX fusion type is a significant prognostic factor for patients with synovial sarcoma.
23716114 Knockdown of SS18-SSX1 in synovial sarcoma inhibits viability and induces apoptosis.
23540691 Studies show that in the 2 synovial sarcoma cell lines used, the fusion of SS18 with SSX leads to assembly of aberrant BAF complexes that become targeted to the Sox2 locus, with loss of repressive H3K27me3 marks, driving Sox2 expression and proliferation of these cells.
22976541 SS18-SSX1 and SS18-SSX2 variant translocations are associated with synovial sarcoma.
22594313 SYT-SSX2 was recruited to distinct loci across all chromosomes, and an overwhelming number of Polycomb-modified sites enriched with the trimethylated histone H3 on lysine 27 (H3K27me3) formed the main recruiting module for SYT-SSX2.
More...

AA Sequence

MSVAFAAPRQRGKGEITPAAIQKMLDDNNHLIQCIMDSQNKGKTSECSQYQQMLHTNLVYLATIADSNQN      1 - 70
MQSLLPAPPTQNMPMGPGGMNQSGPPPPPRSHNMPSDGMVGGGPPAPHMQNQMNGQMPGPNHMPMQGPGP     71 - 140
NQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQPMGNYGPRPNMSMQPNQGPMMHQQP    141 - 210
PSQQYNMPQGGGQHYQGQQPPMGMMGQVNQGNHMMGQRQIPPYRPPQQGPPQQYSGQEDYYGDQYSHGGQ    211 - 280
GPPEGMNQQYYPDGHNDYGYQQPSYPEQGYDRPYEDSSQHYYEGGNSQYGQQQDAYQGPPPQQGYPPQQQ    281 - 350
QYPGQQGYPGQQQGYGPSQGGPGPQYPNYPQGQGQQYGGYRPTQPGPPQPPQQRPYGYDQGQYGNYQQ      351 - 418
//

Text Mined References (56)

PMID Year Title
25959879 2015 Detection of Rare Variant of SS18-SSX1 Fusion Gene and Mutations of Important Cancer-Related Genes in Synovial Sarcoma of the Lip: Gene Analyses of a Case and Literature Review.
25343990 2015 Genome-wide association study of selenium concentrations.
24922679 2014 Synovial sarcoma in knee joint, mimicking low-grade sarcoma confirmed by molecular detection of SYT gene split.
24429587 2014 SS18-bronchial biphasic synovial sarcoma in an octogenarian with hemothorax.
24166495 2014 SS18-SSX fusion protein-induced Wnt/?-catenin signaling is a therapeutic target in synovial sarcoma.
24130893 2013 Truncated SSX protein suppresses synovial sarcoma cell proliferation by inhibiting the localization of SS18-SSX fusion protein.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
24022186 2013 The clinical implication of SS18-SSX fusion gene in synovial sarcoma.
23716114 2014 Loss of SS18-SSX1 inhibits viability and induces apoptosis in synovial sarcoma.
23585552 2013 Genome-wide association study identifies genetic risk underlying primary rhegmatogenous retinal detachment.
More...