Property Summary

NCBI Gene PubMed Count 18
PubMed Score 9.80
PubTator Score 6.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.0e-04
Disease Target Count Z-score Confidence
Atypical autism 26 4.315 2.2

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 1.0e-04

Gene RIF (5)

AA Sequence

MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVR      1 - 70
AGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYSSSSS     71 - 140
LCEANDLPLCEAYGRLDLDTDSADGLSAPLLASPEPSAGPLQVAAPAHSHAGGPGPTEHA              141 - 200
//

Text Mined References (21)

PMID Year Title