Property Summary

NCBI Gene PubMed Count 45
PubMed Score 112.55
PubTator Score 106.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
ovarian cancer 8520 3.7e-07
Multiple myeloma 1332 2.7e-04
intraductal papillary-mucinous adenoma (IPMA) 2955 8.8e-04
osteosarcoma 7950 1.8e-03
psoriasis 6694 2.2e-03
Disease Target Count Z-score Confidence
Brain disease 96 3.219 1.6
Lactic acidosis 51 3.081 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.200 8.8e-04
Multiple myeloma 1.340 2.7e-04
osteosarcoma 1.030 1.8e-03
ovarian cancer -1.400 3.7e-07
psoriasis 1.100 2.2e-03

Protein-protein Interaction (1)

Gene RIF (27)

AA Sequence

MAAVAALQLGLRAAGLGRAPASAAWRSVLRVSPRPGVAWRPSRCGSSAAEASATKAEDDSFLQWVLLLIP      1 - 70
VTAFGLGTWQVQRRKWKLNLIAELESRVLAEPVPLPADPMELKNLEYRPVKVRGCFDHSKELYMMPRTMV     71 - 140
DPVREAREGGLISSSTQSGAYVVTPFHCTDLGVTILVNRGFVPRKKVNPETRQKGQIEGEVDLIGMVRLT    141 - 210
ETRQPFVPENNPERNHWHYRDLEAMARITGAEPIFIDANFQSTVPGGPIGGQTRVTLRNEHLQYIVTWYG    211 - 280
LSAATSYLWFKKFLRGTPGV                                                      281 - 300
//

Text Mined References (50)

PMID Year Title