Property Summary

NCBI Gene PubMed Count 3
PubMed Score 9.78
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q15513 Q4EW09 Q6NSB9
Symbols

Gene

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MTRIKISVCICFRYFEFCFFYALNILFQKVSEANSQTELLLRPHCKNILFNVSFMIDLQAAHF             1 - 63
//

Text Mined References (4)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7799938 1995 Irreversible repression of DNA synthesis in Fanconi anemia cells is alleviated by the product of a novel cyclin-related gene.