Property Summary

NCBI Gene PubMed Count 3
PubMed Score 9.78
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q15513 Q4EW09 Q6NSB9
Symbols

Gene

 GO Process (1)

 Compartment GO Term (0)

 HCA RNA Cell Line (1)

AA Sequence

MTRIKISVCICFRYFEFCFFYALNILFQKVSEANSQTELLLRPHCKNILFNVSFMIDLQAAHF             1 - 63
//

Text Mined References (4)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7799938 1995 Irreversible repression of DNA synthesis in Fanconi anemia cells is alleviated by the product of a novel cyclin-related gene.