Property Summary

NCBI Gene PubMed Count 3
PubMed Score 9.78
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q15513 Q4EW09 Q6NSB9
Symbols

Gene

 GO Process (1)

 Compartment GO Term (0)

 HCA RNA Cell Line (1)

AA Sequence

MTRIKISVCICFRYFEFCFFYALNILFQKVSEANSQTELLLRPHCKNILFNVSFMIDLQAAHF             1 - 63
//

Text Mined References (4)

PMID Year Title