Property Summary

NCBI Gene PubMed Count 33
PubMed Score 27.32
PubTator Score 79.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
acute myeloid leukemia -1.700 3.3e-02
atypical teratoid/rhabdoid tumor 1.200 1.3e-04
ductal carcinoma in situ 1.100 1.2e-02
ependymoma 3.000 4.2e-02
glioblastoma 1.100 2.6e-05
group 3 medulloblastoma 1.900 4.0e-05
intraductal papillary-mucinous neoplasm ... 1.500 1.1e-02
lung cancer -1.200 3.4e-02
nasopharyngeal carcinoma -2.500 2.8e-07
primitive neuroectodermal tumor 1.500 1.4e-03

Synonym

Accession Q15506 B2R4F2 Q9BXF7
Symbols CT22
SP17
SP17-1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (18)

AA Sequence

MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYN      1 - 70
NHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTN     71 - 140
SLQNEEKEENK                                                               141 - 151
//

Text Mined References (34)

PMID Year Title