Property Summary

NCBI Gene PubMed Count 32
PubMed Score 25.16
PubTator Score 79.95

Knowledge Summary

Patent

No data available

Expression

Gene RIF (18)

PMID Text
26300426 dendritic cells from human umbilical cord blood modulated for SP17 expression induced antigen-specific anti-tumor immunity against SP17(+) non-small cell lung cancer.
25739119 SP17/AKAP4/PTTG1 are expressed in both human NSCLC cell lines and primary tumors and can elicit an immunogenic response in lung cancer patients.
25600306 Sp17 and ASP cancer/testis antigens were found in ciliated cells of four ciliated hepatic foregut cysts (CHFCs). Further characterization of Sp17 and ASP in patients with CHFCs may provide significant clues for understanding the molecular mechanisms underlying their predisposition to develop squamous cell carcinomas.
24103781 NY-ESO-1 and SP17 was not significantly associated with a specific histotype, but high-level GAGE expression was more frequent in squamous cell carcinoma. GAGE expression was demonstrated to be significantly higher in stage II-IIIa than stage I NSCLC.
23923079 Sp17 is highly expressed in hepatocellular carcinoma cells
23137323 SP17 was expressed in many cancer types with an overall frequency of 12%. SP17 was most frequently expressed in a different set of cancer types than MAGE-A and GAGE antigens and rarely overlapped with these proteins.
20712874 Sperm protein 17 is highly expressed in endometrial and cervical cancers.
19744347 HSp17 plays a role in metastatic disease and resistance of epithelial ovarian carcinoma to chemotherapy
19685492 Data show that cisplatin induced decrease in Sp17 levels was due to transcriptional inhibition and cisplatin-resistant cell lines did not show this decrease in Sp17 levels in response to cisplatin treatment.
19604394 Results suggest a possible role of Sp17 in regulating sperm maturation, capacitation, acrosomal reaction and interactions with the oocyte zona pellucida during the fertilization process.
More...

AA Sequence

MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYN      1 - 70
NHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTN     71 - 140
SLQNEEKEENK                                                               141 - 151
//

Text Mined References (33)

PMID Year Title
26300426 Umbilical cord blood-derived dendritic cells infected by adenovirus for SP17 expression induce antigen-specific cytotoxic T cells against NSCLC cells.
25739119 2015 Novel antigens in non-small cell lung cancer: SP17, AKAP4, and PTTG1 are potential immunotherapeutic targets.
25600306 2015 Sperm protein 17 and AKAP-associated sperm protein cancer/testis antigens are expressed in ciliated hepatic foregut cysts.
25416956 2014 A proteome-scale map of the human interactome network.
24103781 2013 Analysis of GAGE, NY-ESO-1 and SP17 cancer/testis antigen expression in early stage non-small cell lung carcinoma.
23923079 2013 Sperm protein 17, MAGE-C1 and NY-ESO-1 in hepatocellular carcinoma: expression frequency and their correlation with clinical parameters.
23137323 2012 Limited SP17 expression within tumors diminishes its therapeutic potential.
20712874 2010 Sperm protein 17 is highly expressed in endometrial and cervical cancers.
19744347 2009 Overexpression of human sperm protein 17 increases migration and decreases the chemosensitivity of human epithelial ovarian cancer cells.
19685492 2010 Sperm protein 17 is a novel marker for predicting cisplatin response in esophageal squamous cancer cell lines.
More...