Property Summary

NCBI Gene PubMed Count 46
Grant Count 61
R01 Count 2
Funding $92,182,508.57
PubMed Score 452.61
PubTator Score 90.15

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q15493 A4FTW1 A8K271 Q53FC9 Q5JRR5 RC
Symbols RC
GNL
SMP30
HEL-S-41

Gene

RGN

PANTHER Protein Class (2)

PDB

3G4E   3G4H   4GNB   4GNC  

Gene RIF (28)

PMID Text
26619319 Study results suggest that senescence marker protein-30 and senescence-associated beta-galactosidase expressions in both nuclear cataract and cortical cataract patients were associated with lens epithelial cells apoptosis.
26171977 results highlighted the importance of RGN as a regulatory protein in Ca2+-dependent signaling pathways and its deregulation of RGN expression by Ca2+o may contribute for onset and progression of PCa.
26072307 immunohistochemistry revealed a significant decrease of regucalcin in human kidney disease tissue vs control kidney tissue, and regucalcin was detected in exosomes isolated from healthy donors' urine but not from kidney disease patients
25847529 data suggest that exogenous regucalcin exerts suppressive effects on the proliferation of human pancreatic cancer cells.
25230901 This review will discuss regarding to an involvement of regucalcin as a suppressor protein in human carcinogenesis in insight into the gene therapy. [review]
25128811 RGN overexpression protected from carcinogen-induced mammary gland tumor development and was linked with reduced proliferation and increased apoptosis. These findings indicated the protective role of RGN in the carcinogenesis of mammary gland.
25050833 The alternatively spliced variants of the regucalcin gene were found to be expressed in various human normal and tumor tissues.
24975685 Overexpression of prostate RGN transgene in the prostate inhibits cell proliferation and apoptotic pathways.
24606440 SMP30 can inhibit the proliferation and invasion of human hepatoma cells and thus can be regarded as a cancer suppressive factor.
23453039 Regucalcin may be a key molecule in lipid metabolic disorder and diabetes--{review}
More...

AA Sequence

MSSIKIECVLPENCRCGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSSVALRQSGGYV      1 - 70
ATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGALYSLFPD     71 - 140
HHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMCIDA    141 - 210
EGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGG    211 - 280
IFKITGLGVKGIAPYSYAG                                                       281 - 299
//

Text Mined References (48)

PMID Year Title
26619319 2015 Expressions of Senescence-Associated ?-Galactosidase and Senescence Marker Protein-30 are Associated with Lens Epithelial Cell Apoptosis.
26171977 2015 Effect of extracellular calcium on regucalcin expression and cell viability in neoplastic and non-neoplastic human prostate cells.
26072307 2015 Kidney tissue proteomics reveals regucalcin downregulation in response to diabetic nephropathy with reflection in urinary exosomes.
25847529 2015 Suppressive effects of exogenous regucalcin on the proliferation of human pancreatic cancer MIA PaCa-2 cells in vitro.
25230901 2015 Involvement of regucalcin as a suppressor protein in human carcinogenesis: insight into the gene therapy.
25128811 2015 Histopathological and in vivo evidence of regucalcin as a protective molecule in mammary gland carcinogenesis.
25050833 2014 Alternatively spliced variants of the regucalcin gene in various human normal and tumor tissues.
24975685 2014 Regucalcin is an androgen-target gene in the rat prostate modulating cell-cycle and apoptotic pathways.
24606440 2014 Inhibition of SMP30 gene expression influences the biological characteristics of human Hep G2 cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...