Property Summary

NCBI Gene PubMed Count 51
PubMed Score 478.16
PubTator Score 90.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Synonym

Accession Q15493 A4FTW1 A8K271 Q53FC9 Q5JRR5 RC
Symbols RC
GNL
SMP30
HEL-S-41

Gene

RGN

PANTHER Protein Class (2)

PDB

3G4E   3G4H   4GNB   4GNC  

  Ortholog (1)

Species Source Disease
Chimp EggNOG Inparanoid

Gene RIF (33)

AA Sequence

MSSIKIECVLPENCRCGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSSVALRQSGGYV      1 - 70
ATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGALYSLFPD     71 - 140
HHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMCIDA    141 - 210
EGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGG    211 - 280
IFKITGLGVKGIAPYSYAG                                                       281 - 299
//

Text Mined References (53)

PMID Year Title