Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 5.94765291178113E-6
glioblastoma 5572 0.0157233702993941

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.156 0.000
glioblastoma -1.200 0.016

AA Sequence

MDRSNPVKPALDYFSNRLVNYQISVKCSNQFKLEVCLLNAENKVVDNQAGTQGQLKVLGANLWWPYLMHE      1 - 70
HPASLYSWEDGDCSHQSLGPLPACDLCDQLHLRSRQGGSVCGCDPCEQLLLLVSQLRAPGVDSAAAGRPV     71 - 140
//

Text Mined References (3)

PMID Year Title
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
7977382 1994 Complex repetitive arrangements of gene sequence in the candidate region of the spinal muscular atrophy gene in 5q13.