Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 2.9e-03
glioblastoma 5792 1.6e-02

Expression

  Differential Expression (2)

Disease log2 FC p
glioblastoma -1.200 1.6e-02
osteosarcoma -1.055 2.9e-03

AA Sequence

MDRSNPVKPALDYFSNRLVNYQISVKCSNQFKLEVCLLNAENKVVDNQAGTQGQLKVLGANLWWPYLMHE      1 - 70
HPASLYSWEDGDCSHQSLGPLPACDLCDQLHLRSRQGGSVCGCDPCEQLLLLVSQLRAPGVDSAAAGRPV     71 - 140
//

Text Mined References (3)

PMID Year Title