Property Summary

NCBI Gene PubMed Count 80
Grant Count 13
R01 Count 2
Funding $3,346,713.01
PubMed Score 191.02
PubTator Score 133.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -2.051 0.000
pancreatic ductal adenocarcinoma liver m... -3.058 0.001
aldosterone-producing adenoma -1.398 0.018
pituitary cancer -1.300 0.000
psoriasis -1.500 0.000

Gene RIF (72)

PMID Text
26464189 association of FCN2 polymorphisms with nephritis and severe cumulative damage in SLE patients; no association with rheumatoid arthritis development
26379154 -557 A>G, -64 A>C and +6424 G>T SNPs of the FCN2 gene were correlated with pulmonary TB.
26207622 FCN2 and MBL2 allele frequencies were similarly distributed in early and late age-related macular degeneration cases compared with controls
26074063 this study provide novel insight in the binding and complement activating capacity of the lectin pathway initiation molecules ficolin-2 and ficolin-3 towards relevant Gram-negative pathogens of pathophysiological relevance.
25965808 Findings indicate the FCN2 variant +6359C>T is associated with the occurrence of visceral leishmaniasis and that ficolin-2 serum levels are elevated in Leishmania infections.
25612732 L-ficolin modulates the immune response to A. fumigatus.
25447524 binding of ficolin-2 to sulfated/phosphated carbohydrates
25344472 paper identifies phosphocholine moieties of pneumococcal teichoic acid as a novel L-ficolin ligand
25251245 CVID patients with bronchiectasis have very low levels of ficolin-2. The reason for the deficiency of ficolin-2 in CVID and any possible causal relationship is currently unknown.
25174443 Ficolin-2 was depleted from plasma during cardiac surgery when using heparin-coated bypass circuits and did not reach baseline level 24 h postoperation.
More...

AA Sequence

MELDRAVGVLGAATLLLSFLGMAWALQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGK      1 - 70
RGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGG     71 - 140
GWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSF    141 - 210
KVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYL    211 - 280
RGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA                                         281 - 313
//

Text Mined References (85)

PMID Year Title
26464189 2016 Ficolin Gene Polymorphisms in Systemic Lupus Erythematosus and Rheumatoid Arthritis.
26379154 2015 Association of the FCN2 Gene Single Nucleotide Polymorphisms with Susceptibility to Pulmonary Tuberculosis.
26207622 2015 Association Study of Mannose-Binding Lectin Levels and Genetic Variants in Lectin Pathway Proteins with Susceptibility to Age-Related Macular Degeneration: A Case-Control Study.
26074063 2015 Studies of the binding of ficolin-2 and ficolin-3 from the complement lectin pathway to Leptospira biflexa, Pasteurella pneumotropica and Diarrheagenic Escherichia coli.
25965808 2015 Association of Ficolin-2 Serum Levels and FCN2 Genetic Variants with Indian Visceral Leishmaniasis.
25612732 2015 The serum opsonin L-ficolin is detected in lungs of human transplant recipients following fungal infections and modulates inflammation and killing of Aspergillus fumigatus.
25447524 2014 Human ficolin-2 recognition versatility extended: an update on the binding of ficolin-2 to sulfated/phosphated carbohydrates.
25344472 2014 Human L-ficolin recognizes phosphocholine moieties of pneumococcal teichoic acid.
25251245 2015 Low ficolin-2 levels in common variable immunodeficiency patients with bronchiectasis.
25174443 2015 Heparin-coated cardiopulmonary bypass circuits selectively deplete the pattern recognition molecule ficolin-2 of the lectin complement pathway in vivo.
More...