Property Summary

NCBI Gene PubMed Count 93
PubMed Score 207.95
PubTator Score 133.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (5)

Disease log2 FC p
aldosterone-producing adenoma -1.398 1.8e-02
osteosarcoma -2.051 8.5e-05
pancreatic ductal adenocarcinoma liver m... -3.058 5.5e-04
pituitary cancer -1.300 6.1e-06
psoriasis -1.500 1.2e-07

Gene RIF (87)

AA Sequence

MELDRAVGVLGAATLLLSFLGMAWALQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGK      1 - 70
RGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGG     71 - 140
GWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSF    141 - 210
KVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYL    211 - 280
RGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA                                         281 - 313
//

Text Mined References (98)

PMID Year Title