Property Summary

NCBI Gene PubMed Count 89
Grant Count 159
R01 Count 103
Funding $18,365,747.16
PubMed Score 406.87
PubTator Score 230.80

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q15475 Q53Y16 Q96H64
Symbols BOS3
TIP39
DFNA23

Gene

PDB

4EGC  

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
651725 screening 2028 / 7304 / 355075 qHTS Assay for Inhibitors of the Six1/Eya2 Interaction
651736 summary 0 / 0 / 0 qHTS Assay for Inhibitors of the Six1/Eya2 Interaction

Gene RIF (60)

PMID Text
26927385 Data show that both Ezrin and SIX1 proteins are highly expressed in alpha fetoprotein-negative hepatocellular carcinoma (HCC) and significantly related with the TNM stage.
26884396 These data suggest differential SIX-factor regulation might have contributed to species differences in nephron progenitor programs such as the duration of nephrogenesis and the final nephron count
26473286 Data show that the protein domain interfaces may represent therapeutic targets in homeo domain protein SIX1-positive Hodgkin lymphoma (HL) subsets.
25951369 High expression of SIX1 is an independent prognostic marker in colorectal cancer.
25798827 Single nucleotide polymorphism in SIX1 gene is associated with primary open angle glaucoma.
25670083 Recurrent mutations included a hotspot mutation (Q177R) in the homeo-domain of SIX1 and SIX2 in tumors with high proliferative potential (18.1% of blastemal cases); mutations in the DROSHA/DGCR8 microprocessor genes
25670082 in tumors with DGCR8 E518K and DROSHA exon 29 (miRNAPG-HS) mutations ... greater prevalence of tumors with blastemal predominant histology in patients with miRNAPG-HS and/or SIX1/2 Q177R mutations
25555392 SIX1 and EYA are often co-overexpressed in tumors, and the SIX1-EYA2 interaction has been shown to be critical for metastasis in a breast cancer model.
25463612 Six1 overexpression in HPV16-immortalized keratinocytes increased cell proliferation and promoted cell migration and invasion by inducing epithelial-mesenchymal transition.
25142796 tumor cells that expressed high levels of SIX1 could promote lymphangiogenesis and counteract the negative effects of TGFbeta on lymphangiogenesis by increasing the expression of VEGF-C
More...

AA Sequence

MSMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKIL      1 - 70
ESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLR     71 - 140
EWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKERENTENNNSSSNKQNQLSPLEGGK    141 - 210
PLMSSSEEEFSPPQSPDQNSVLLLQGNMGHARSSNYSLPGLTASQPSHGLQTHQHQLQDSLLGPLTSSLV    211 - 280
DLGS                                                                      281 - 284
//

Text Mined References (87)

PMID Year Title
26927385 2016 [Clinicopathological significance of ezrin and SIX1 protein expression in alpha fetoprotein-negative hepatocellular carcinoma].
26884396 2016 Differential regulation of mouse and human nephron progenitors by the Six family of transcriptional regulators.
26473286 2015 Aberrant expression of homeobox gene SIX1 in Hodgkin lymphoma.
26235987 2015 Mutations in TBX18 Cause Dominant Urinary Tract Malformations via Transcriptional Dysregulation of Ureter Development.
25951369 2015 Overexpression of SIX1 is an independent prognostic marker in stage I-III colorectal cancer.
25798827 2015 Genetic association of SNPs near ATOH7, CARD10, CDKN2B, CDC7 and SIX1/SIX6 with the endophenotypes of primary open angle glaucoma in Indian population.
25670083 2015 Mutations in the SIX1/2 pathway and the DROSHA/DGCR8 miRNA microprocessor complex underlie high-risk blastemal type Wilms tumors.
25670082 2015 Recurrent DGCR8, DROSHA, and SIX homeodomain mutations in favorable histology Wilms tumors.
25555392 2015 The SIX1-EYA transcriptional complex as a therapeutic target in cancer.
25463612 2015 Six1 overexpression at early stages of HPV16-mediated transformation of human keratinocytes promotes differentiation resistance and EMT.
More...