Property Summary

NCBI Gene PubMed Count 104
PubMed Score 433.69
PubTator Score 230.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count
Abnormal collecting system 2
Abnormality of the cerebrum 3
Absent auditory canals 23
Absent external auditory canals 23
Atresia of the external auditory canal 23
Atretic auditory canal 23
BRANCHIOOTIC SYNDROME 1 2
BRANCHIOOTIC SYNDROME 3 (disorder) 1
Branchioma 3
Bulbous internal auditory canal 5
Byzanthine arch palate 194
Cholesteatoma 16
Cleft Palate 271
Cleft uvula 27
Commissural lip pit 1
Conductive hearing loss 123
Congenital Abnormality 11
Congenital absence of kidney 31
Congenital deafness 185
Congenital malrotation of intestine 16
Deafness 198
Decreased size of teeth 62
Decreased width of tooth 59
Deep overbite 4
Enlarged cochlear aqueduct 2
Euthyroid Goiter 3
Fistula of branchial cleft 2
Gustatory lacrimation 2
Hearing Loss, Mixed Conductive-Sensorineural 12
Hearing Loss, Partial 185
Highly variable severity 157
Hip Dislocation, Congenital 48
Hypoplastic cochlea 6
Incomplete partition of the cochlea type II 3
Long face 71
Malformed ossicles 3
Malformed pinnae 37
Malrotation of kidney 2
Microdontia (disorder) 59
Middle ear malformations 5
Mondini malformation 3
Narrow face 54
Narrowing of ear canal 13
Overbite 4
Polycystic Kidney - body part 18
Polycystic Kidney Diseases 20
Posterior lingual occlusion of mandibular teeth 4
Preauricular Fistulae, Congenital 27
Preauricular dimple 27
Preauricular sinus 27
Preauricular skin tag 19
RENAL ADYSPLASIA 25
Renal dysplasia 28
Renal hypoplasia/aplasia 7
Renal steatosis 4
Sensorineural Hearing Loss (disorder) 284
Skin tag on the posterior cheek 19
Stenosis of external auditory canal 13
Stenosis of nasolacrimal duct 4
Thin face 54
Uranostaphyloschisis 167
Variable expressivity 157
Vesico-Ureteral Reflux 33
hearing impairment 199
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Glaucoma 239 4.278 2.1
Eye and adnexa disease 18 0.0 0.7
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 0.0 4.0

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma 1.900 2.3e-04
Astrocytoma, Pilocytic 2.700 5.0e-05
atypical teratoid / rhabdoid tumor 2.200 4.3e-04
Breast cancer 2.100 4.2e-02
breast carcinoma 1.300 4.5e-14
glioblastoma 2.500 1.2e-04
group 4 medulloblastoma 2.000 3.7e-02
intraductal papillary-mucinous neoplasm ... 1.800 2.5e-02
invasive ductal carcinoma 1.800 5.2e-03
lung adenocarcinoma 2.800 5.1e-08
lung cancer 3.600 1.2e-04
lung carcinoma 2.200 4.2e-16
malignant mesothelioma 1.400 1.1e-04
medulloblastoma, large-cell 2.300 1.4e-02
nasopharyngeal carcinoma -1.200 1.0e-03
non primary Sjogren syndrome sicca 1.200 2.0e-02
non-small cell lung cancer 1.736 2.8e-15
ovarian cancer 1.900 2.7e-03

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (74)

AA Sequence

MSMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKIL      1 - 70
ESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLR     71 - 140
EWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKERENTENNNSSSNKQNQLSPLEGGK    141 - 210
PLMSSSEEEFSPPQSPDQNSVLLLQGNMGHARSSNYSLPGLTASQPSHGLQTHQHQLQDSLLGPLTSSLV    211 - 280
DLGS                                                                      281 - 284
//

Text Mined References (102)

PMID Year Title