Property Summary

NCBI Gene PubMed Count 108
Grant Count 254
R01 Count 180
Funding $28,724,886.29
PubMed Score 550.45
PubTator Score 250.13

Knowledge Summary

Patent (41,489)

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 1.900 0.000
pancreatic cancer -1.200 0.001

Synonym

Accession Q15466 F1D8P5 Q5QP36
Symbols SHP
SHP1

Gene

PDB

2Z4J   1YUC   4DOR   4ONI   2Q3Y  

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (89)

PMID Text
26553876 Data suggest that LRH1/NR5A2 (liver receptor homologue-1) exhibits phospholipid-mediated allosteric control of protein-protein binding interface in interactions with TIF2 (co-activator; transcription intermediary factor 2) and SHP.
26421305 These findings show that POD-1/TCF21 regulates SF-1 and LRH-1 by distinct mechanisms, contributing to the understanding of POD-1 involvement and its mechanisms of action in adrenal and liver tumorigenesis.
25976932 Overexpression of SHP and activation of AMPK reverses profibrogenic features of HCV-infected cells by decreasing TGF-beta and fibrotic gene expression.
25720568 At the molecular level, estrogen upregulated hepatic SHP expression through binding to its proximal promoter. In addition, the roles of estrogen were largely blunted in mice with SHP deficiency.
25655831 These data are suggestive of a role for SHP in controlling NLRP3 inflammasome activation through a mechanism involving interaction with NLRP3 and maintenance of mitochondrial homeostasis.
25015078 These results establish SHP as a novel antihypertrophic regulator that acts by interfering with GATA6 signaling.
24619556 E2F1 transcription factor activates early growth response (Egr)-1 promoter which is repressed by SHP and EIA-like inhibitor of differentiation (EID)1.
24379397 An unexpected EID1-binding site on SHP is located at the N terminus of the receptor, where EID1 mimics helix H1 of the nuclear receptor ligand-binding domain.
24365583 Activation of the VDR represses hepatic SHP to increase levels of CYP7A1 and reduce cholesterol.
24343129 SHP regulates PDCD5-mediated apoptosis in cancer cells
More...

AA Sequence

MSTSQPGACPCQGAASRPAILYALLSSSLKAVPRPRSRCLCRQHRPVQLCAPHRTCREALDVLAKTVAFL      1 - 70
RNLPSFWQLPPQDQRRLLQGCWGPLFLLGLAQDAVTFEVAEAPVPSILKKILLEEPSSSGGSGQLPDRPQ     71 - 140
PSLAAVQWLQCCLESFWSLELSPKEYACLKGTILFNPDVPGLQAASHIGHLQQEAHWVLCEVLEPWCPAA    141 - 210
QGRLTRVLLTASTLKSIPTSLLGDLFFRPIIGDVDIAGLLGDMLLLR                           211 - 257
//

Text Mined References (108)

PMID Year Title
26553876 2016 Unexpected Allosteric Network Contributes to LRH-1 Co-regulator Selectivity.
26421305 2015 POD-1/TCF21 Reduces SHP Expression, Affecting LRH-1 Regulation and Cell Cycle Balance in Adrenocortical and Hepatocarcinoma Tumor Cells.
25976932 2015 Small heterodimer partner attenuates profibrogenic features of hepatitis C virus-infected cells.
25720568 2015 Hepatic estrogen receptor ? improves hepatosteatosis through upregulation of small heterodimer partner.
25655831 2015 Small heterodimer partner interacts with NLRP3 and negatively regulates activation of the NLRP3 inflammasome.
25015078 2014 Small heterodimer partner blocks cardiac hypertrophy by interfering with GATA6 signaling.
24619556 2014 E2F1 is a novel fibrogenic gene that regulates cholestatic liver fibrosis through the Egr-1/SHP/EID1 network.
24379397 2014 Structural insights into gene repression by the orphan nuclear receptor SHP.
24365583 2014 Vitamin D receptor activation down-regulates the small heterodimer partner and increases CYP7A1 to lower cholesterol.
24343129 2014 NF-?B p65 recruited SHP regulates PDCD5-mediated apoptosis in cancer cells.
More...