Property Summary

NCBI Gene PubMed Count 396
PubMed Score 2672.52
PubTator Score 1051.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (8)

Disease Target Count
Basal cell carcinoma of skin 2
Disease Target Count Z-score Confidence
Coloboma 52 3.594 1.8
Disease Target Count Z-score Confidence
Microphthalmia 79 3.275 1.6

Expression

Synonym

Accession Q15465 A4D247 Q75MC9 SHH
Symbols TPT
HHG1
HLP3
HPE3
SMMCI
TPTPS
MCOPCB5

Gene

SHH

PDB

3HO5   3M1N   3MXW  

  Ortholog (10)

Gene RIF (354)

PMID Text
26997450 Increased SHH, PTCH, and GLI1 protein correlated positively with tumor grade, tumor depth and lymph node metastasis in Peutz-Jeghers syndrome.
26943330 hyperactivity of Hh signaling resulted in EGFR-TKI resistance, by EMT introduction and ABCG2 upregulation, and blockade of Hh signaling synergistically increased sensitivity to EGFR-TKIs in primary and secondary resistant NSCLC cells
26825960 MAPK and SHH pathways modulate type 3 deiodinase expression in papillary thyroid carcinoma
26773496 Here we show that MITF-A mRNA is predominantly expressed in all three human liver cancer cell lines examined.
26691363 The serum levels of IHH and SHH were significantly higher in autistic subjects than those of control subjects. The findings support a correlation between SHH, IHH and BDNF in autistic children, suggesting their pathological role in autism
26689865 Data suggest that nicotine increases the SHH-mediated malignant potential of pancreatic cancer stem cells and that GABA prevents these effects.
26676748 appears to be responsive to the inhibition of GALNT1 and SHH signaling
26592459 Studies indicate crosstalk between Notch receptor and Wnt protein, Hedgehog protein, hypoxia and transforming growth factor beta (TGFbeta)/bone morphogenetic protein (BMP) pathways.
26586670 Demonstrated that sonic hedgehog is a PRL-regulated cytokine in breast cancer cells and part of the mechanism that induces osteoclast differentiation.
26499980 This article reviews the most relevant functions of Shh during cerebellar ontogenesis, underlying its role in physiological and pathological conditions. [review]
More...

AA Sequence

MLLLARCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNS      1 - 70
ERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLH     71 - 140
YEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGGCFPGSATVHLEQG    141 - 210
GTKLVKDLSPGDRVLAADDQGRLLYSDFLTFLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDS    211 - 280
ATGEPEASSGSGPPSGGALGPRALFASRVRPGQRVYVVAERDGDRRLLPAAVHSVTLSEEAAGAYAPLTA    281 - 350
QGTILINRVLASCYAVIEEHSWAHRAFAPFRLAHALLAALAPARTDRGGDSGGGDRGGGGGRVALTAPGA    351 - 420
ADAPGAGATAGIHWYSQLLYQIGTWLLDSEALHPLGMAVKSS                                421 - 462
//

Text Mined References (403)

PMID Year Title
26997450 2016 Aberrant expression of Sonic hedgehog signaling in Peutz-Jeghers syndrome.
26943330 2016 Blockade of Hedgehog Signaling Synergistically Increases Sensitivity to Epidermal Growth Factor Receptor Tyrosine Kinase Inhibitors in Non-Small-Cell Lung Cancer Cell Lines.
26825960 2016 MAPK and SHH pathways modulate type 3 deiodinase expression in papillary thyroid carcinoma.
26773496 2016 Induction of MITF expression in human cholangiocarcinoma cells and hepatocellular carcinoma cells by cyclopamine, an inhibitor of the Hedgehog signaling.
26691363 2015 Correlation Between Hedgehog (Hh) Protein Family and Brain-Derived Neurotrophic Factor (BDNF) in Autism Spectrum Disorder (ASD).
26689865 2016 Nicotine induces self-renewal of pancreatic cancer stem cells via neurotransmitter-driven activation of sonic hedgehog signalling.
26676748 2016 GALNT1-Mediated Glycosylation and Activation of Sonic Hedgehog Signaling Maintains the Self-Renewal and Tumor-Initiating Capacity of Bladder Cancer Stem Cells.
26592459 2016 The Notch intracellular domain integrates signals from Wnt, Hedgehog, TGF?/BMP and hypoxia pathways.
26586670 2016 The Role of Prolactin in Bone Metastasis and Breast Cancer Cell-Mediated Osteoclast Differentiation.
26499980 2016 Sonic hedgehog patterning during cerebellar development.
More...