Property Summary

NCBI Gene PubMed Count 32
Grant Count 28
R01 Count 20
Funding $1,256,636.39
PubMed Score 135.76
PubTator Score 133.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.326 0.000
intraductal papillary-mucinous adenoma (... 1.200 0.005
interstitial cystitis 1.100 0.002
lung carcinoma -1.300 0.000
acute myeloid leukemia 2.300 0.015
ovarian cancer 1.200 0.000

Gene RIF (7)

PMID Text
22815959 cytohesin inhibition has an antiproliferative effect in gefitinib-resistant lung cancer cells
21511340 findings suggest that cytohesin-1 is a key regulator of neutrophil adhesion to endothelial cells and to components of extracellular matrix, which may influence cell emigration through its dual opposing effect on beta2 and beta1 integrin activation
20018626 involvement of cytohesin-1 in the regulation of the functional responses of human PMNs, linked, in part at least, to the activation of Arf6.
19346499 demonstrate an essential role of cytohesin-1/RhoA during ameboid migration in the presence of integrins
15778383 findings reveal that mycobacteria promote their uptake through a process of "inside-out" signaling involving CD14, TLR2, PI3K, and cytohesin-1. This converts low avidity CR3 into an active receptor leading to increased bacterial internalization
12606567 Data show that CYTIP and cytoadhesin-1 are upregulated during dendritic cell maturation.
11438522 Phosphorylated cytohesin-1 is able to tightly associate with the actin cytoskeleton, and is required for maximal leukocyte function antigen-1-mediated adhesion of Jurkat cells to Icam-1.

AA Sequence

MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNMQRNKQVAMGR      1 - 70
KKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERDEFNIQVLHAFVELHEFTDLN     71 - 140
LVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVFQSTDTCYVLSFAIIMLNTSLHNPNVKDKPT    141 - 210
VERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKR    211 - 280
RWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEG    281 - 350
NHTVYRISAPTPEEKEEWIKCIKAAISRDPFYEMLAARKKKVSSTKRH                          351 - 398
//

Text Mined References (34)

PMID Year Title
24047446 2013 Genome-wide association study of co-occurring anxiety in major depression.
22815959 2012 Anti-proliferative effect of cytohesin inhibition in gefitinib-resistant lung cancer cells.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21628335 2011 Editorial: Cytohesin-1, on the tail of two integrins.
21511340 2011 Cytohesin-1 regulates human blood neutrophil adhesion to endothelial cells through ?2 integrin activation.
20018626 2010 Cytohesin-1 regulates the Arf6-phospholipase D signaling axis in human neutrophils: impact on superoxide anion production and secretion.
19346499 2009 Cytohesin-1 controls the activation of RhoA and modulates integrin-dependent adhesion and migration of dendritic cells.
17398095 2007 The Arl4 family of small G proteins can recruit the cytohesin Arf6 exchange factors to the plasma membrane.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15778383 2005 Cross-talk between CD14 and complement receptor 3 promotes phagocytosis of mycobacteria: regulation by phosphatidylinositol 3-kinase and cytohesin-1.
More...