Property Summary

NCBI Gene PubMed Count 34
PubMed Score 140.23
PubTator Score 133.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
acute myeloid leukemia 2.300 1.5e-02
interstitial cystitis 1.100 1.7e-03
intraductal papillary-mucinous adenoma (... 1.200 4.5e-03
lung carcinoma -1.300 2.9e-24
osteosarcoma -2.326 1.2e-06
ovarian cancer -1.100 1.1e-04

Gene RIF (9)

AA Sequence

MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNMQRNKQVAMGR      1 - 70
KKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERDEFNIQVLHAFVELHEFTDLN     71 - 140
LVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVFQSTDTCYVLSFAIIMLNTSLHNPNVKDKPT    141 - 210
VERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKR    211 - 280
RWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEG    281 - 350
NHTVYRISAPTPEEKEEWIKCIKAAISRDPFYEMLAARKKKVSSTKRH                          351 - 398
//

Text Mined References (36)

PMID Year Title