Property Summary

NCBI Gene PubMed Count 34
PubMed Score 158.67
PubTator Score 83.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Anemia, Dyserythropoietic, Congenital 4 0.0 0.0
Cowden-Like Syndrome 6 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Congenital hemolytic anemia 32 0.0 4.0
Disease Target Count Z-score Confidence
Anemia 365 5.757 2.9
Siderosis 9 3.911 2.0
Hemochromatosis 54 3.014 1.5

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma 1.100 3.0e-02
Breast cancer 3.900 2.7e-02
ductal carcinoma in situ 1.100 2.1e-03
invasive ductal carcinoma 1.400 6.2e-03
non primary Sjogren syndrome sicca 1.100 3.2e-02
osteosarcoma -2.070 5.8e-07
ovarian cancer -1.100 3.6e-03
pancreatic ductal adenocarcinoma liver m... -1.013 1.9e-02
tuberculosis and treatment for 6 months -1.100 5.0e-04

Protein-protein Interaction (10)

Gene RIF (18)

AA Sequence

MATYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPDLPPVQYEPVLCSRPTCKAVL      1 - 70
NPLCQVDYRAKLWACNFCFQRNQFPPAYGGISEVNQPAELMPQFSTIEYVIQRGAQSPLIFLYVVDTCLE     71 - 140
EDDLQALKESLQMSLSLLPPDALVGLITFGRMVQVHELSCEGISKSYVFRGTKDLTAKQIQDMLGLTKPA    141 - 210
MPMQQARPAQPQEHPFASSRFLQPVHKIDMNLTDLLGELQRDPWPVTQGKRPLRSTGVALSIAVGLLEGT    211 - 280
FPNTGARIMLFTGGPPTQGPGMVVGDELKIPIRSWHDIEKDNARFMKKATKHYEMLANRTAANGHCIDIY    281 - 350
ACALDQTGLLEMKCCANLTGGYMVMGDSFNTSLFKQTFQRIFTKDFNGDFRMAFGATLDVKTSRELKIAG    351 - 420
AIGPCVSLNVKGPCVSENELGVGGTSQWKICGLDPTSTLGIYFEVVNQHNTPIPQGGRGAIQFVTHYQHS    421 - 490
STQRRIRVTTIARNWADVQSQLRHIEAAFDQEAAAVLMARLGVFRAESEEGPDVLRWLDRQLIRLCQKFG    491 - 560
QYNKEDPTSFRLSDSFSLYPQFMFHLRRSPFLQVFNNSPDESSYYRHHFARQDLTQSLIMIQPILYSYSF    561 - 630
HGPPEPVLLDSSSILADRILLMDTFFQIVIYLGETIAQWRKAGYQDMPEYENFKHLLQAPLDDAQEILQA    631 - 700
RFPMPRYINTEHGGSQARFLLSKVNPSQTHNNLYAWGQETGAPILTDDVSLQVFMDHLKKLAVSSAC       701 - 767
//

Text Mined References (38)

PMID Year Title