Property Summary

NCBI Gene PubMed Count 26
Grant Count 13
R01 Count 10
Funding $979,438.38
PubMed Score 20.84
PubTator Score 14.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

 GO Function (1)

Gene RIF (10)

PMID Text
24069399 ALG-2 attenuates COPII budding in vitro and stabilizes the Sec23/Sec31A complex.
23994533 show that membrane association of COPII components, and in particular of Sec23a, is impaired by ER stress-inducing agents suggesting the existence of a dynamic interplay between protein folding and COPII assembly at the ER
23658022 Data indicate that a synthetic polypeptide containing the N terminus of bovine AE1 bound the Sec23A-Sec24C complex through a selective interaction with Sec24C.
23453696 Hypomorphic mutations of SEC23B gene account for mild phenotypes of congenital dyserythropoietic anemia type II.
22495181 the BBF2H7-mediated Sec23A pathway is required for ER-to-Golgi procollagen trafficking to promote collagen synthesis
21593139 Sec23A overexpression reduced cell growth but did not induce apoptosis, whereas inhibition of Sec23A stimulated cell proliferation
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18713835 Data show that coupling of the Sec23/24 and Sec13/31 layers of the COPII coat is required to drive export of collagen from the endoplasmic reticulum, and that efficient COPII assembly is essential for normal craniofacial development during embryogenesis.
17981133 Sec23A mutation causes cranio-lenticulo-sutural dysplasia, and disrupts the nucleation of COPII coat proteins at endoplasmic reticulum exit sites.
15013749 When entering into mitosis, the COPII component Sec24Cp is simultaneously deglycosylated and phosphorylated; however, Sec23A is not.

AA Sequence

MTTYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPVAALFTPLKERPDLPPIQYEPVLCSRTTCRAVL      1 - 70
NPLCQVDYRAKLWACNFCYQRNQFPPSYAGISELNQPAELLPQFSSIEYVVLRGPQMPLIFLYVVDTCME     71 - 140
DEDLQALKESMQMSLSLLPPTALVGLITFGRMVQVHELGCEGISKSYVFRGTKDLSAKQLQEMLGLSKVP    141 - 210
LTQATRGPQVQQPPPSNRFLQPVQKIDMNLTDLLGELQRDPWPVPQGKRPLRSSGVALSIAVGLLECTFP    211 - 280
NTGARIMMFIGGPATQGPGMVVGDELKTPIRSWHDIDKDNAKYVKKGTKHFEALANRAATTGHVIDIYAC    281 - 350
ALDQTGLLEMKCCPNLTGGYMVMGDSFNTSLFKQTFQRVFTKDMHGQFKMGFGGTLEIKTSREIKISGAI    351 - 420
GPCVSLNSKGPCVSENEIGTGGTCQWKICGLSPTTTLAIYFEVVNQHNAPIPQGGRGAIQFVTQYQHSSG    421 - 490
QRRIRVTTIARNWADAQTQIQNIAASFDQEAAAILMARLAIYRAETEEGPDVLRWLDRQLIRLCQKFGEY    491 - 560
HKDDPSSFRFSETFSLYPQFMFHLRRSSFLQVFNNSPDESSYYRHHFMRQDLTQSLIMIQPILYAYSFSG    561 - 630
PPEPVLLDSSSILADRILLMDTFFQILIYHGETIAQWRKSGYQDMPEYENFRHLLQAPVDDAQEILHSRF    631 - 700
PMPRYIDTEHGGSQARFLLSKVNPSQTHNNMYAWGQESGAPILTDDVSLQVFMDHLKKLAVSSAA         701 - 765
//

Text Mined References (33)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24069399 2013 ALG-2 attenuates COPII budding in vitro and stabilizes the Sec23/Sec31A complex.
23994533 2013 Endoplasmic reticulum stress reduces COPII vesicle formation and modifies Sec23a cycling at ERESs.
23658022 2013 A new class of endoplasmic reticulum export signal PhiXPhiXPhi for transmembrane proteins and its selective interaction with Sec24C.
23453696 2013 Hypomorphic mutations of SEC23B gene account for mild phenotypes of congenital dyserythropoietic anemia type II.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22495181 2012 BBF2H7-mediated Sec23A pathway is required for endoplasmic reticulum-to-Golgi trafficking in dermal fibroblasts to promote collagen synthesis.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21593139 2011 Downregulation of Sec23A protein by miRNA-375 in prostate carcinoma.
More...