Property Summary

NCBI Gene PubMed Count 25
Grant Count 8
R01 Count 6
Funding $918,104.56
PubMed Score 36.84
PubTator Score 15.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.011 0.004
Multiple myeloma 1.589 0.000
astrocytic glioma -1.800 0.008
psoriasis 1.800 0.001
atypical teratoid / rhabdoid tumor -1.600 0.000
glioblastoma -1.200 0.000
medulloblastoma -1.400 0.000
medulloblastoma, large-cell -1.800 0.000
adult high grade glioma -1.500 0.000
non primary Sjogren syndrome sicca 1.300 0.029
ovarian cancer 2.400 0.000
dermatomyositis 1.300 0.001

Gene RIF (6)

PMID Text
26168397 there is a second, parallel signalling pathway which triggers the relaxation of the polar cell cortex at mid anaphase--independent of furrow formation, centrosomes and microtubules, pathway depends on PP1 phosphatase and regulatory subunit Sds22
25298395 a model in which I3 regulates an SDS22-mediated PP1 activation step in solution that precedes SDS22 dissociation and transfer of PP1 to kinetochores, and which is required for PP1 to efficiently antagonize Aurora B.
22801782 It was shown that Repo-Man and Sds22 contribute to timely Aurora B kinase substrate dephosphorylation on anaphase chromatin.
21399659 human Sds22 is focally deleted and downregulated in multiple carcinomas, and this downregulation correlates with tumor progression, suggesting that sds22 inactivation may contribute to tumorigenesis and metastatic potential
20921135 Sds22 specifically defines protein phosphatase 1 function and localization in mitosis.
17630778 Sds22 and Inhibitor-3 form a heterotrimeric complex with PP1, both in cell lysates and after purification. A pool of PP1 is complexly controlled by both Sds22 and Inhibitor-3.

AA Sequence

MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPEEEHELPVDME      1 - 70
TINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEA     71 - 140
LTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENIDTLTNL    141 - 210
ESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLD    211 - 280
IASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSV    281 - 350
RQIDATFVRF                                                                351 - 360
//

Text Mined References (34)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26168397 2015 Kinetochore-localized PP1-Sds22 couples chromosome segregation to polar relaxation.
25416956 2014 A proteome-scale map of the human interactome network.
25298395 2014 Inhibitor-3 ensures bipolar mitotic spindle attachment by limiting association of SDS22 with kinetochore-bound protein phosphatase-1.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...