Property Summary

NCBI Gene PubMed Count 29
PubMed Score 37.96
PubTator Score 15.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.400 3.5e-04
astrocytic glioma -1.700 1.3e-02
atypical teratoid / rhabdoid tumor -1.500 7.0e-07
dermatomyositis 1.300 1.1e-03
glioblastoma -1.200 2.2e-04
group 4 medulloblastoma -1.200 3.4e-04
medulloblastoma, large-cell -1.800 2.2e-06
Multiple myeloma 1.174 1.6e-03
non primary Sjogren syndrome sicca 1.300 2.9e-02
ovarian cancer -1.300 5.6e-05
psoriasis 1.800 5.9e-04
Waldenstrons macroglobulinemia 1.011 3.6e-03

Gene RIF (8)

AA Sequence

MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPEEEHELPVDME      1 - 70
TINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEA     71 - 140
LTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENIDTLTNL    141 - 210
ESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLD    211 - 280
IASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSV    281 - 350
RQIDATFVRF                                                                351 - 360
//

Text Mined References (38)

PMID Year Title