Property Summary

NCBI Gene PubMed Count 10
PubMed Score 30.86
PubTator Score 16.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 4.56041110928844E-26
non-small cell lung cancer 2798 1.19181077116809E-18
lung adenocarcinoma 2714 5.6290163551053E-16
Breast cancer 3099 3.82568352438364E-15
ovarian cancer 8492 3.91185392453038E-8
ductal carcinoma in situ 1745 1.0702939386667E-4
invasive ductal carcinoma 2950 2.99550366291937E-4
spina bifida 1064 0.0300023370070231

Expression

  Differential Expression (8)

Disease log2 FC p
non-small cell lung cancer -1.688 0.000
lung adenocarcinoma -1.200 0.000
lung carcinoma -1.900 0.000
spina bifida -2.326 0.030
Breast cancer -1.400 0.000
ductal carcinoma in situ -1.300 0.000
invasive ductal carcinoma -2.100 0.000
ovarian cancer -1.900 0.000

Synonym

Accession Q15434
Symbols SCR3

Gene

PDB

1X4E  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

AA Sequence

MLLSVTSRPGISTFGYNRNNKKPYVSLAQQMAPPSPSNSTPNSSSGSNGNDQLSKTNLYIRGLQPGTTDQ      1 - 70
DLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPSAAQKAVTALKASGVQAQMAKQQEQDPTNLYIS     71 - 140
NLPLSMDEQELEGMLKPFGQVISTRILRDTSGTSRGVGFARMESTEKCEAIITHFNGKYIKTPPGVPAPS    141 - 210
DPLLCKFADGGPKKRQNQGKFVQNGRAWPRNADMGVMALTYDPTTALQNGFYPAPYNITPNRMLAQSALS    211 - 280
PYLSSPVSSYQRVTQTSPLQVPNPSWMHHHSYLMQPSGSVLTPGMDHPISLQPASMMGPLTQQLGHLSLS    281 - 350
STGTYMPTAAAMQGAYISQYTPVPSSSVSVEESSGQQNQVAVDAPSEHGVYSFQFNK                 351 - 407
//

Text Mined References (18)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22479202 2012 Novel loci for adiponectin levels and their influence on type 2 diabetes and metabolic traits: a multi-ethnic meta-analysis of 45,891 individuals.
20214974 2010 Identification of long stress-induced non-coding transcripts that have altered expression in cancer.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
More...