Property Summary

NCBI Gene PubMed Count 31
Grant Count 4
R01 Count 4
Funding $241,382.63
PubMed Score 19.87
PubTator Score 12.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
psoriasis -1.900 0.000
sonic hedgehog group medulloblastoma 1.700 0.000
astrocytoma 1.200 0.006
atypical teratoid / rhabdoid tumor 1.600 0.000
glioblastoma 1.600 0.000
medulloblastoma, large-cell 1.900 0.000
primitive neuroectodermal tumor 1.100 0.001
ovarian cancer 1.600 0.000
Gaucher disease type 1 1.300 0.019

Gene RIF (4)

PMID Text
24916648 A genome-wide association study identifies PLCL2 and AP3D1-DOT1L-SF3A2 as new susceptibility loci for myocardial infarction in Japanese
22174317 HIV-1 Rev interacting protein, splicing factor 3a, subunit 2 (SF3A2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with SF3A2 is increased by RRE
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15647371 SF3a60, 66, and 120, but not SF1, are essential for pre-mRNA splicing

AA Sequence

MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYL      1 - 70
AHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDSEMGQQSLLFQIDYPE     71 - 140
IAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQF    141 - 210
HFKMEKPPAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQL    211 - 280
PPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAPGVHPPAPGVHPPTSGVHPPAPGVHPPAPGVHPPAPGV    281 - 350
HPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPAAPAVHPQAPGVHPPAPGMHPQAPGVHPQPPGVHPSAPG    351 - 420
VHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPPTN                              421 - 464
//

Text Mined References (34)

PMID Year Title
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
24916648 2015 A genome-wide association study identifies PLCL2 and AP3D1-DOT1L-SF3A2 as new susceptibility loci for myocardial infarction in Japanese.
24304693 2014 Identification of a novel component C2ORF3 in the lariat-intron complex: lack of C2ORF3 interferes with pre-mRNA splicing via intron turnover pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21269460 2011 Initial characterization of the human central proteome.
20467437 2010 Direct interaction between hnRNP-M and CDC5L/PLRG1 proteins affects alternative splice site choice.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...