Property Summary

NCBI Gene PubMed Count 31
PubMed Score 19.87
PubTator Score 12.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 3.38988080074049E-8
ovarian cancer 8492 3.13940548550683E-7
atypical teratoid / rhabdoid tumor 4369 8.92495512863823E-7
malignant mesothelioma 3163 6.46314944871459E-6
sonic hedgehog group medulloblastoma 1482 3.17404176343271E-5
medulloblastoma, large-cell 6234 5.25959707518662E-5
glioblastoma 5572 5.31404318155389E-5
primitive neuroectodermal tumor 3031 0.00115466773031366
astrocytoma 1493 0.00550086959142453
Gaucher disease type 1 171 0.0187710851896836

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
psoriasis -1.900 0.000
sonic hedgehog group medulloblastoma 1.700 0.000
astrocytoma 1.200 0.006
atypical teratoid / rhabdoid tumor 1.600 0.000
glioblastoma 1.600 0.000
medulloblastoma, large-cell 1.900 0.000
primitive neuroectodermal tumor 1.100 0.001
ovarian cancer 1.600 0.000
Gaucher disease type 1 1.300 0.019

Synonym

Accession Q15428 B2RBU1 D6W605 O75245
Symbols PRP11
SAP62
PRPF11
SF3a66

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish EggNOG Inparanoid

Gene RIF (4)

PMID Text
24916648 A genome-wide association study identifies PLCL2 and AP3D1-DOT1L-SF3A2 as new susceptibility loci for myocardial infarction in Japanese
22174317 HIV-1 Rev interacting protein, splicing factor 3a, subunit 2 (SF3A2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with SF3A2 is increased by RRE
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15647371 SF3a60, 66, and 120, but not SF1, are essential for pre-mRNA splicing

AA Sequence

MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYL      1 - 70
AHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDSEMGQQSLLFQIDYPE     71 - 140
IAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQF    141 - 210
HFKMEKPPAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQL    211 - 280
PPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAPGVHPPAPGVHPPTSGVHPPAPGVHPPAPGVHPPAPGV    281 - 350
HPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPAAPAVHPQAPGVHPPAPGMHPQAPGVHPQPPGVHPSAPG    351 - 420
VHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPPTN                              421 - 464
//

Text Mined References (34)

PMID Year Title
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
24916648 2015 A genome-wide association study identifies PLCL2 and AP3D1-DOT1L-SF3A2 as new susceptibility loci for myocardial infarction in Japanese.
24304693 2014 Identification of a novel component C2ORF3 in the lariat-intron complex: lack of C2ORF3 interferes with pre-mRNA splicing via intron turnover pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21269460 2011 Initial characterization of the human central proteome.
20467437 2010 Direct interaction between hnRNP-M and CDC5L/PLRG1 proteins affects alternative splice site choice.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...