Property Summary

NCBI Gene PubMed Count 31
PubMed Score 19.87
PubTator Score 12.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma 1.200 5.5e-03
atypical teratoid / rhabdoid tumor 1.600 8.9e-07
Gaucher disease type 1 1.300 1.9e-02
glioblastoma 1.600 5.3e-05
group 4 medulloblastoma 1.200 8.4e-04
malignant mesothelioma 1.200 2.5e-05
medulloblastoma, large-cell 1.900 5.3e-05
ovarian cancer 1.600 3.1e-07
primitive neuroectodermal tumor 1.100 1.2e-03
psoriasis -1.100 3.5e-05

Gene RIF (4)

AA Sequence

MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYL      1 - 70
AHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDSEMGQQSLLFQIDYPE     71 - 140
IAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQF    141 - 210
HFKMEKPPAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQL    211 - 280
PPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAPGVHPPAPGVHPPTSGVHPPAPGVHPPAPGVHPPAPGV    281 - 350
HPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPAAPAVHPQAPGVHPPAPGMHPQAPGVHPQPPGVHPSAPG    351 - 420
VHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPPTN                              421 - 464
//

Text Mined References (34)

PMID Year Title