Property Summary

Ligand Count 6
NCBI Gene PubMed Count 153
PubMed Score 337.99
PubTator Score 151.90

Knowledge Summary

Patent (27,926)


  Disease (4)

Disease Target Count Z-score Confidence
Sezary Syndrome 27 0.0 0.0
Disease Target Count P-value
lung carcinoma 2843 8.9e-24
osteosarcoma 7950 1.8e-06
tuberculosis 2010 1.8e-05
ductal carcinoma in situ 1745 1.3e-03
psoriasis 6694 1.5e-03
invasive ductal carcinoma 2951 1.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 4.425 2.2
Coffin-Lowry syndrome 9 4.135 2.1
Vascular disease 319 3.07 1.5


  Differential Expression (6)

Disease log2 FC p
ductal carcinoma in situ 1.300 1.3e-03
invasive ductal carcinoma 1.100 1.3e-02
lung carcinoma -1.100 8.9e-24
osteosarcoma -3.771 1.8e-06
psoriasis -1.500 1.5e-03
tuberculosis 1.300 1.8e-05

Gene RIF (68)

AA Sequence

TYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL                                       701 - 735

Text Mined References (166)

PMID Year Title