Property Summary

NCBI Gene PubMed Count 148
Grant Count 122
R01 Count 93
Funding $6,530,253.22
PubMed Score 321.09
PubTator Score 151.90

Knowledge Summary

Patent (27,926)

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.500 0.001
osteosarcoma -3.771 0.000
tuberculosis 1.300 0.000
lung carcinoma -1.100 0.000
ductal carcinoma in situ 1.300 0.001
invasive ductal carcinoma 1.100 0.013

Synonym

Accession Q15418 A6NGG4 A8K9K7 B2RDY8 B7Z5J0 E9PRI4 Q5SVM5 Q5SVM8 Q5SVM9 Q96C05 Q9BQK2 S6K-alpha-1
Symbols RSK
HU-1
RSK1
p90Rsk
MAPKAPK1A

Gene

PDB

3TEI   4H3P   4NIF   2WNT   2Z7Q   2Z7R   2Z7S   3RNY   5CSF   5CSI   5CSJ   5CSN  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (63)

PMID Text
26977024 RSK1 and 3 but not RSK2 are down-regulated in breast tumour and are associated with disease progression. RSK may be a key component in the progression and metastasis of breast cancer.
26625210 Data show that the 90 kDa ribosomal protein S6 kinases RSK1 and RSK2 play a key role in the homing of ovarian cancer cells in metastatic sites by regulating cell adhesion and invasion.
26580203 PKD2 and RSK1 regulate integrin beta4 phosphorylation at threonine 1736 to stabilize keratinocyte cell adhesion and its hemidesmosomes.
26158630 Results indicate that the phosphorylation of EphA2 at Ser-897 is controlled by RSK and the RSK-EphA2 axis might contribute to cell motility and promote tumour malignant progression.
25889895 SL0101 and BI-D1870 induce distinct off-target effects in mTORC1-p70S6K signaling, and thus, the functions previously ascribed to RSK1/2 based on these inhibitors should be reassessed.
25730857 Structural assembly of the signaling competent ERK2-RSK1 heterodimeric protein kinase complex.
25689261 p90RSK-mediated SENP2-T368 phosphorylation is a master switch in disturbed-flow-induced signaling.
25579842 RSK1 was constitutively phosphorylated at Ser-380 in nodular but not superficial spreading melanoma and did not directly correlate with BRAF or MEK activation. RSK1 orchestrated a program of gene expression that promoted cell motility and invasion.
25513777 findings demonstrate that Yersinia enterocolitica rYopM interacts with RSK1 and PRK2 following cell-penetration
25320298 These results suggest a critical role for ORF45-mediated p90 Ribosomal S6 Kinase activation in Kaposi's sarcoma-associated herpesvirus lytic replication.
More...

AA Sequence

MPLAQLKEPWPLMELVPLDPENGQTSGEEAGLQPSKDEGVLKEISITHHVKAGSEKADPSHFELLKVLGQ      1 - 70
GSFGKVFLVRKVTRPDSGHLYAMKVLKKATLKVRDRVRTKMERDILADVNHPFVVKLHYAFQTEGKLYLI     71 - 140
LDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSK    141 - 210
EAIDHEKKAYSFCGTVEYMAPEVVNRQGHSHSADWWSYGVLMFEMLTGSLPFQGKDRKETMTLILKAKLG    211 - 280
MPQFLSTEAQSLLRALFKRNPANRLGSGPDGAEEIKRHVFYSTIDWNKLYRREIKPPFKPAVAQPDDTFY    281 - 350
FDTEFTSRTPKDSPGIPPSAGAHQLFRGFSFVATGLMEDDGKPRAPQAPLHSVVQQLHGKNLVFSDGYVV    351 - 420
KETIGVGSYSECKRCVHKATNMEYAVKVIDKSKRDPSEEIEILLRYGQHPNIITLKDVYDDGKHVYLVTE    421 - 490
LMRGGELLDKILRQKFFSEREASFVLHTIGKTVEYLHSQGVVHRDLKPSNILYVDESGNPECLRICDFGF    491 - 560
AKQLRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRIG    561 - 630
SGKFTLSGGNWNTVSETAKDLVSKMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAA    631 - 700
TYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL                                       701 - 735
//

Text Mined References (161)

PMID Year Title
26977024 2016 The Clinical Implications of RSK1-3 in Human Breast Cancer.
26625210 2016 Peritoneal and hematogenous metastases of ovarian cancer cells are both controlled by the p90RSK through a self-reinforcing cell autonomous mechanism.
26580203 2015 PKD2 and RSK1 Regulate Integrin ?4 Phosphorylation at Threonine 1736.
26158630 2015 Crucial roles of RSK in cell motility by catalysing serine phosphorylation of EphA2.
25889895 2015 Two widely used RSK inhibitors, BI-D1870 and SL0101, alter mTORC1 signaling in a RSK-independent manner.
25730857 2015 Structural assembly of the signaling competent ERK2-RSK1 heterodimeric protein kinase complex.
25689261 2015 Disturbed flow-activated p90RSK kinase accelerates atherosclerosis by inhibiting SENP2 function.
25579842 2015 RSK1 activation promotes invasion in nodular melanoma.
25513777 2014 Manipulation of pro-inflammatory cytokine production by the bacterial cell-penetrating effector protein YopM is independent of its interaction with host cell kinases RSK1 and PRK2.
25320298 2015 Activation of p90 ribosomal S6 kinases by ORF45 of Kaposi's sarcoma-associated herpesvirus is critical for optimal production of infectious viruses.
More...