Property Summary

NCBI Gene PubMed Count 24
Grant Count 4
Funding $226,564.33
PubMed Score 13.54
PubTator Score 12.57

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
26175098 overexpressed CNN3 during sonic vibration increases expression of glutamate receptors and promotes functional neural differentiation of human umbilical cords-mesenchymal stem cells.
25050546 CNN3 as a new pro-invasive protein in trophoblast cells that is induced under low oxygen conditions.
23545751 Participates in actin stress fiber remodeling
22119193 The mRNA and protein level of calponin-3 were increase expression in brain in patiens with epilepsy.
20861310 Results indicate that CNN3 regulates actin cytoskeleton rearrangement which is required for the plasma membranes of trophoblasts to become fusion competent.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18927281 Gene rearrangements of CNN3 is associated with mucosa-associated lymphoid tissue lymphoma.
17825283 These results suggest a role of calponin 3 in the regulation of Bone morphogenetic proteins -dependent cellular responses.

AA Sequence

MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCELINKLQPGSV      1 - 70
KKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDI     71 - 140
GVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGT    141 - 210
NKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPV    211 - 280
IHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY                         281 - 329
//

Text Mined References (29)

PMID Year Title
26175098 2015 Overexpressed Calponin3 by Subsonic Vibration Induces Neural Differentiation of hUC-MSCs by Regulating the Ionotropic Glutamate Receptor.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25050546 2014 CNN3 regulates trophoblast invasion and is upregulated by hypoxia in BeWo cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23545751 2013 Calponin 3 regulates stress fiber formation in dermal fibroblasts during wound healing.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
22119193 2012 Increased expression of calponin-3 in epileptic patients and experimental rats.
21492153 2011 Analysis of proteomic changes induced upon cellular differentiation of the human intestinal cell line Caco-2.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
More...