Property Summary

NCBI Gene PubMed Count 25
PubMed Score 227.48
PubTator Score 69.93

Knowledge Summary

Patent (9,897)

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 6.4e-12
osteosarcoma 7950 3.7e-05
malignant mesothelioma 3232 3.9e-05
psoriasis 6694 1.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
chronic kidney disease 90 3.105 1.6
Epidermodysplasia verruciformis 21 3.048 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.300 3.9e-05
osteosarcoma 1.093 3.7e-05
ovarian cancer 1.400 6.4e-12
psoriasis 1.300 1.4e-03

Gene RIF (9)

AA Sequence

MERDEPPPSGGGGGGGSAGFLEPPAALPPPPRNGFCQDELAELDPGTISVSDDRAEQRTCLICGDRATGL      1 - 70
HYGIISCEGCKGFFKRSICNKRVYRCSRDKNCVMSRKQRNRCQYCRLLKCLQMGMNRKAIREDGMPGGRN     71 - 140
KSIGPVQISEEEIERIMSGQEFEEEANHWSNHGDSDHSSPGNRASESNQPSPGSTLSSSRSVELNGFMAF    141 - 210
REQYMGMSVPPHYQYIPHLFSYSGHSPLLPQQARSLDPQSYSLIHQLLSAEDLEPLGTPMLIEDGYAVTQ    211 - 280
AELFALLCRLADELLFRQIAWIKKLPFFCELSIKDYTCLLSSTWQELILLSSLTVYSKQIFGELADVTAK    281 - 350
YSPSDEELHRFSDEGMEVIERLIYLYHKFHQLKVSNEEYACMKAINFLNQDIRGLTSASQLEQLNKRYWY    351 - 420
ICQDFTEYKYTHQPNRFPDLMMCLPEIRYIAGKMVNVPLEQLPLLFKVVLHSCKTSVGKE              421 - 480
//

Text Mined References (27)

PMID Year Title