Property Summary

NCBI Gene PubMed Count 32
Grant Count 13
R01 Count 9
Funding $1,588,187.07
PubMed Score 34.43
PubTator Score 20.82

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
26170296 integrin/Rsu1/Rac1/actin signaling has a conserved role in modulating reward-related phenotypes, including ethanol consumption, across phyla
25750304 results showed that RSU-1 expression is elevated in HepG2 cells both at the mRNA and protein level
25647720 Upregulation of RSU1 is associated with metastatic breast cancer.
25482629 Rsu1 is required for EGF-induced activation of the p38 map kinase signaling
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18436335 Rsu-1 links the Ras pathway with the IPP (integrin-linked kinase {ILK}, PINCH-1/LIMS1, parvin) complex and the perturbations of cell attachment-dependent signaling that occur in the malignant process
16385451 Observational study of gene-disease association. (HuGE Navigator)
12510772 alternative splicing of exon 8 of the RSU-1 RNA to produce the exon-deleted form constitutes a mechanism for reduction or loss of functional Rsu-1. The exon-deleted form was not found in normal tissue.

AA Sequence

MSKSLKKLVEESREKNQPEVDMSDRGISNMLDVNGLFTLSHITQLVLSHNKLTMVPPNIAELKNLEVLNF      1 - 70
FNNQIEELPTQISSLQKLKHLNLGMNRLNTLPRGFGSLPALEVLDLTYNNLSENSLPGNFFYLTTLRALY     71 - 140
LSDNDFEILPPDIGKLTKLQILSLRDNDLISLPKEIGELTQLKELHIQGNRLTVLPPELGNLDLTGQKQV    141 - 210
FKAENNPWVTPIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRKPLAAKNR       211 - 277
//

Text Mined References (36)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26170296 2015 Rsu1 regulates ethanol consumption in Drosophila and humans.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25750304 2015 Elimination of Ras Suppressor-1 from hepatocellular carcinoma cells hinders their in vitro metastatic properties.
25647720 2015 Ras suppressor-1 promotes apoptosis in breast cancer cells by inhibiting PINCH-1 and activating p53-upregulated-modulator of apoptosis (PUMA); verification from metastatic breast cancer human samples.
25482629 2015 Rsu1 contributes to cell adhesion and spreading in MCF10A cells via effects on P38 map kinase signaling.
25416956 2014 A proteome-scale map of the human interactome network.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
More...