Property Summary

NCBI Gene PubMed Count 33
PubMed Score 36.35
PubTator Score 20.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma 1.100 1.7e-02
Astrocytoma, Pilocytic 1.500 1.1e-06
atypical teratoid / rhabdoid tumor 1.100 1.2e-02
glioblastoma 1.300 1.6e-07
malignant mesothelioma -1.700 2.5e-07
ovarian cancer 1.800 1.5e-03
pediatric high grade glioma 1.300 6.8e-06
posterior fossa group A ependymoma 1.200 5.0e-07
Rheumatoid arthritis 1.300 2.9e-02
subependymal giant cell astrocytoma 1.770 1.9e-02
tuberculosis 1.200 4.8e-04

Protein-protein Interaction (4)

Gene RIF (9)

AA Sequence

MSKSLKKLVEESREKNQPEVDMSDRGISNMLDVNGLFTLSHITQLVLSHNKLTMVPPNIAELKNLEVLNF      1 - 70
FNNQIEELPTQISSLQKLKHLNLGMNRLNTLPRGFGSLPALEVLDLTYNNLSENSLPGNFFYLTTLRALY     71 - 140
LSDNDFEILPPDIGKLTKLQILSLRDNDLISLPKEIGELTQLKELHIQGNRLTVLPPELGNLDLTGQKQV    141 - 210
FKAENNPWVTPIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRKPLAAKNR       211 - 277
//

Text Mined References (37)

PMID Year Title