Property Summary

NCBI Gene PubMed Count 174
Grant Count 173
R01 Count 93
Funding $17,891,095.09
PubMed Score 353.35
PubTator Score 204.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
hepatocellular carcinoma 1.100 0.000
urothelial carcinoma -1.500 0.003
malignant mesothelioma -1.700 0.000
cutaneous lupus erythematosus 1.400 0.012
osteosarcoma -1.696 0.034
posterior fossa group B ependymoma 1.900 0.000
glioblastoma 2.100 0.001
lung cancer -1.900 0.001
pediatric high grade glioma 1.900 0.000
pilocytic astrocytoma 2.200 0.000
lung carcinoma -1.800 0.000
Breast cancer -1.400 0.000
ulcerative colitis 1.700 0.000
ovarian cancer -1.900 0.000

Synonym

Accession Q15399 D1CS39 D1CS41 O15452 Q32MK3 Q32MK4 Q9UG90
Symbols TIL
CD281
rsc786
TIL. LPRS5

Gene

PANTHER Protein Class (1)

PDB

1FYV   2Z7X  

Gene RIF (165)

PMID Text
26738805 The data suggest that genetic variation in TLR1 has effects on the host response to Plasmodium falciparum malaria in Asian populations.
26729809 a novel mechanism of action for TLR1 SNP rs5743618 in modulating polymorphonuclear leukocytes priming responses.
26633000 a case-control study of 504 Papua New Guinean children with severe malaria showed that a genetic variant in TLR1 may contribute to the low severe malaria case fatality rates in this region through a reduced pro-inflammatory cellular phenotype.
26559190 concluded that TLR-1 rs4833095 and TLR10 rs10004195 confer susceptibility to development of gastroduodenal disease, especially GC in H.pylori disease
26470427 Frequencies of TLR1-TLR6 two-locus haplotypes in major populations of South Urals were determined for the first time.
26347747 HIV-1 gp41 binds TLR1 (from TZM-bl-2 cell lysates)
26347747 HIV-1 gp41 binds TLR1 (from TZM-bl-2 cell lysates)
26347747 HIV-1 gp41 binds TLR1 (from TZM-bl-2 cell lysates)
26347747 HIV-1 gp41 binds TLR1 (from TZM-bl-2 cell lysates)
25969543 Activation of MyD88-dependent TLR1/2 signaling by misfolded alpha-synuclein, a protein linked to neurodegenerative disorders.
More...

AA Sequence

MTSIFHFAIIFMLILQIRIQLSEESEFLVDRSKNGLIHVPKDLSQKTTILNISQNYISELWTSDILSLSK      1 - 70
LRILIISHNRIQYLDISVFKFNQELEYLDLSHNKLVKISCHPTVNLKHLDLSFNAFDALPICKEFGNMSQ     71 - 140
LKFLGLSTTHLEKSSVLPIAHLNISKVLLVLGETYGEKEDPEGLQDFNTESLHIVFPTNKEFHFILDVSV    141 - 210
KTVANLELSNIKCVLEDNKCSYFLSILAKLQTNPKLSNLTLNNIETTWNSFIRILQLVWHTTVWYFSISN    211 - 280
VKLQGQLDFRDFDYSGTSLKALSIHQVVSDVFGFPQSYIYEIFSNMNIKNFTVSGTRMVHMLCPSKISPF    281 - 350
LHLDFSNNLLTDTVFENCGHLTELETLILQMNQLKELSKIAEMTTQMKSLQQLDISQNSVSYDEKKGDCS    351 - 420
WTKSLLSLNMSSNILTDTIFRCLPPRIKVLDLHSNKIKSIPKQVVKLEALQELNVAFNSLTDLPGCGSFS    421 - 490
SLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELGEFVKNIDQVSSEVLEGWPDSYKCDYPE    491 - 560
SYRGTLLKDFHMSELSCNITLLIVTIVATMLVLAVTVTSLCSYLDLPWYLRMVCQWTQTRRRARNIPLEE    561 - 630
LQRNLQFHAFISYSGHDSFWVKNELLPNLEKEGMQICLHERNFVPGKSIVENIITCIEKSYKSIFVLSPN    631 - 700
FVQSEWCHYELYFAHHNLFHEGSNSLILILLEPIPQYSIPSSYHKLKSLMARRTYLEWPKEKSKRGLFWA    701 - 770
NLRAAINIKLTEQAKK                                                          771 - 786
//

Text Mined References (176)

PMID Year Title
26738805 2016 A common TLR1 polymorphism is associated with higher parasitaemia in a Southeast Asian population with Plasmodium falciparum malaria.
26729809 2016 A Common Genetic Variant in TLR1 Enhances Human Neutrophil Priming and Impacts Length of Intensive Care Stay in Pediatric Sepsis.
26633000 A Toll-like receptor-1 variant and its characteristic cellular phenotype is associated with severe malaria in Papua New Guinean children.
26559190 2015 Polymorphisms at Locus 4p14 of Toll-Like Receptors TLR-1 and TLR-10 Confer Susceptibility to Gastric Carcinoma in Helicobacter pylori Infection.
26470427 [DISTRIBUTION OF TWO-LOCUS HAPLOTYPES OF MICROBIAL COMPONENT SENSOR GENES TLR1 AND TLR6 IN MAJOR POPULATIONS OF SOUTH URALS].
25969543 2015 Activation of MyD88-dependent TLR1/2 signaling by misfolded ?-synuclein, a protein linked to neurodegenerative disorders.
25857934 2015 Toll-like receptor 1 variations influence susceptibility and immune response to Mycobacterium tuberculosis.
25850295 [Association of polymorphisms in toll-like receptor genes with atopic dermatitis in the Republic of Bashkortostan].
25784560 2015 Association of Toll-like receptor 2 Arg753Gln and Toll-like receptor 1 Ile602Ser single-nucleotide polymorphisms with leptospirosis in an Argentine population.
25722298 2015 Genetic Variation in Pattern Recognition Receptors and Adaptor Proteins Associated With Development of Chronic Q Fever.
More...