Property Summary

NCBI Gene PubMed Count 187
PubMed Score 374.70
PubTator Score 204.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma 1.400 8.8e-03
Astrocytoma, Pilocytic 2.300 1.4e-09
Breast cancer -1.400 2.0e-06
cutaneous lupus erythematosus 1.400 1.2e-02
ependymoma 1.800 1.5e-08
glioblastoma 1.700 4.2e-05
hepatocellular carcinoma 1.100 3.5e-04
lung cancer -1.900 5.9e-04
lung carcinoma -1.800 1.4e-18
malignant mesothelioma -1.700 3.8e-05
osteosarcoma -1.696 3.4e-02
ovarian cancer -1.900 5.8e-07
ulcerative colitis 1.700 2.7e-04
urothelial carcinoma -1.500 3.4e-03

 CSPA Cell Line (1)

Gene RIF (173)

AA Sequence

MTSIFHFAIIFMLILQIRIQLSEESEFLVDRSKNGLIHVPKDLSQKTTILNISQNYISELWTSDILSLSK      1 - 70
LRILIISHNRIQYLDISVFKFNQELEYLDLSHNKLVKISCHPTVNLKHLDLSFNAFDALPICKEFGNMSQ     71 - 140
LKFLGLSTTHLEKSSVLPIAHLNISKVLLVLGETYGEKEDPEGLQDFNTESLHIVFPTNKEFHFILDVSV    141 - 210
KTVANLELSNIKCVLEDNKCSYFLSILAKLQTNPKLSNLTLNNIETTWNSFIRILQLVWHTTVWYFSISN    211 - 280
VKLQGQLDFRDFDYSGTSLKALSIHQVVSDVFGFPQSYIYEIFSNMNIKNFTVSGTRMVHMLCPSKISPF    281 - 350
LHLDFSNNLLTDTVFENCGHLTELETLILQMNQLKELSKIAEMTTQMKSLQQLDISQNSVSYDEKKGDCS    351 - 420
WTKSLLSLNMSSNILTDTIFRCLPPRIKVLDLHSNKIKSIPKQVVKLEALQELNVAFNSLTDLPGCGSFS    421 - 490
SLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELGEFVKNIDQVSSEVLEGWPDSYKCDYPE    491 - 560
SYRGTLLKDFHMSELSCNITLLIVTIVATMLVLAVTVTSLCSYLDLPWYLRMVCQWTQTRRRARNIPLEE    561 - 630
LQRNLQFHAFISYSGHDSFWVKNELLPNLEKEGMQICLHERNFVPGKSIVENIITCIEKSYKSIFVLSPN    631 - 700
FVQSEWCHYELYFAHHNLFHEGSNSLILILLEPIPQYSIPSSYHKLKSLMARRTYLEWPKEKSKRGLFWA    701 - 770
NLRAAINIKLTEQAKK                                                          771 - 786
//

Text Mined References (189)

PMID Year Title