Property Summary

NCBI Gene PubMed Count 52
Grant Count 21
R01 Count 9
Funding $3,763,206.34
PubMed Score 160.24
PubTator Score 118.06

Knowledge Summary

Patent

No data available

Expression

Gene RIF (42)

PMID Text
26288822 DHCR24 auto-antibody represents a potential noninvasive biomarker for hepatitis C virus-related liver disease and may facilitate the diagnosis of PIVKA-II and AFP-negative hepatocellular carcinoma.
25637936 physical and functional interaction between DHCR24 and DHCR7
24916565 Data (including data from studies using RNA from post-mortem brain tissue) suggest that expression of DHCR24 is up-regulated in parietal cortex of patients with Huntington's disease as compared to control subjects.
24562935 In vitro experiments showed that DHCR24 overexpression induced tumor proliferation.
24489783 DHCR24 expression protects neuronal cells from apoptotic cell death induced by endoplasmic reticulum stress.
24363437 Data indicate a mechanism whereby 3beta-hydroxysterol Delta24-reductase (DHCR24) activity is regulated by signaling.
23416078 TR-beta and LXR-alpha competitively up-regulate the human Seladin-1 promoter, sharing the same response element, site A.
23123430 Inflammation is inhibited in coronary artery endothlial cells by increasing 3beta-hydroxysteroid-Delta24 reductase expression.
23050906 DHCR24 gene expression is regulation by cholesterol availability.
22910610 a gender dependent effect of DHCR24 rs600491 polymorphism on the susceptibility to Alzheimer disease.
More...

AA Sequence

MEPAVSLAVCALLFLLWVRLKGLEFVLIHQRWVFVCLFLLPLSLIFDIYYYVRAWVVFKLSSAPRLHEQR      1 - 70
VRDIQKQVREWKEQGSKTFMCTGRPGWLTVSLRVGKYKKTHKNIMINLMDILEVDTKKQIVRVEPLVTMG     71 - 140
QVTALLTSIGWTLPVLPELDDLTVGGLIMGTGIESSSHKYGLFQHICTAYELVLADGSFVRCTPSENSDL    141 - 210
FYAVPWSCGTLGFLVAAEIRIIPAKKYVKLRFEPVRGLEAICAKFTHESQRQENHFVEGLLYSLDEAVIM    211 - 280
TGVMTDEAEPSKLNSIGNYYKPWFFKHVENYLKTNREGLEYIPLRHYYHRHTRSIFWELQDIIPFGNNPI    281 - 350
FRYLFGWMVPPKISLLKLTQGETLRKLYEQHHVVQDMLVPMKCLQQALHTFQNDIHVYPIWLCPFILPSQ    351 - 420
PGLVHPKGNEAELYIDIGAYGEPRVKHFEARSCMRQLEKFVRSVHGFQMLYADCYMNREEFWEMFDGSLY    421 - 490
HKLREKLGCQDAFPEVYDKICKAARH                                                491 - 516
//

Text Mined References (57)

PMID Year Title
26288822 2015 Serum DHCR24 Auto-antibody as a new Biomarker for Progression of Hepatitis C.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25637936 2015 The terminal enzymes of cholesterol synthesis, DHCR24 and DHCR7, interact physically and functionally.
24916565 2014 Altered expression of 3-betahydroxysterol delta-24-reductase/selective Alzheimer's disease indicator-1 gene in Huntington's disease models.
24562935 2014 DHCR24 is an independent predictor of progression in patients with non-muscle-invasive urothelial carcinoma, and its functional role is involved in the aggressive properties of urothelial carcinoma cells.
24489783 2014 3 ?-hydroxysteroid-? 24 reductase (DHCR24) protects neuronal cells from apoptotic cell death induced by endoplasmic reticulum (ER) stress.
24363437 2014 Signaling regulates activity of DHCR24, the final enzyme in cholesterol synthesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23416078 2013 Thyroid hormone receptor and liver X receptor competitively up-regulate human selective Alzheimer's disease indicator-1 gene expression at the transcriptional levels.
23123430 2013 High-density lipoproteins inhibit vascular endothelial inflammation by increasing 3?-hydroxysteroid-?24 reductase expression and inducing heme oxygenase-1.
More...