Property Summary

NCBI Gene PubMed Count 53
PubMed Score 167.34
PubTator Score 118.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

 OMIM Phenotype (1)

Protein-protein Interaction (6)

Gene RIF (43)

AA Sequence

MEPAVSLAVCALLFLLWVRLKGLEFVLIHQRWVFVCLFLLPLSLIFDIYYYVRAWVVFKLSSAPRLHEQR      1 - 70
VRDIQKQVREWKEQGSKTFMCTGRPGWLTVSLRVGKYKKTHKNIMINLMDILEVDTKKQIVRVEPLVTMG     71 - 140
QVTALLTSIGWTLPVLPELDDLTVGGLIMGTGIESSSHKYGLFQHICTAYELVLADGSFVRCTPSENSDL    141 - 210
FYAVPWSCGTLGFLVAAEIRIIPAKKYVKLRFEPVRGLEAICAKFTHESQRQENHFVEGLLYSLDEAVIM    211 - 280
TGVMTDEAEPSKLNSIGNYYKPWFFKHVENYLKTNREGLEYIPLRHYYHRHTRSIFWELQDIIPFGNNPI    281 - 350
FRYLFGWMVPPKISLLKLTQGETLRKLYEQHHVVQDMLVPMKCLQQALHTFQNDIHVYPIWLCPFILPSQ    351 - 420
PGLVHPKGNEAELYIDIGAYGEPRVKHFEARSCMRQLEKFVRSVHGFQMLYADCYMNREEFWEMFDGSLY    421 - 490
HKLREKLGCQDAFPEVYDKICKAARH                                                491 - 516
//

Text Mined References (58)

PMID Year Title