Property Summary

NCBI Gene PubMed Count 34
Grant Count 25
R01 Count 21
Funding $2,738,722.6
PubMed Score 45.23
PubTator Score 55.69

Knowledge Summary

Patent (5,467)

Expression

Gene RIF (9)

PMID Text
24847057 UDP-glucose activates P2Y14 receptor and JAK2, increases STAT3 Tyr705 phosphorylation, and enhances transcription of HAS2.
23592514 PPTN as a highly selective high-affinity antagonist of the P2Y14-R.
23333304 HIV-1 Vif downregulates the expression of purinergic receptor P2Y, G-protein coupled, 14 (P2RY14) in Vif-expression T cells
22673622 These results support the notion that UDP-glucose is a stable and potent proinflammatory mediator that promotes P2Y(14)-R-mediated neutrophil motility via Rho/Rho kinase activation.
19454705 UDP-glucose stimulated IL-8 production via P2RY14 in human endometrial epithelial cells but not stromal cells
18690346 We have demonstrated the presence of P2Y(14) receptor protein in platelets, but no contribution of this receptor to several measures of platelet function has been observed
12902497 Discrete expression of GPR105 demonstrated within the immature subset of monocyte-derived dendritic cells (DC) suggests a possible role for this receptor in DC activation.
12842911 a G-protein-coupled receptor identifying a quiescent, primitive population of hematopoietic cells restricted to bone marrow; it mediates primitive cell responses to specific hematopoietic microenvironments
12559763 The IUPHAR Subcommittee for P2Y receptor nomenclature and classification reviews the current knowledge of the UDP-glucose receptor and presents reasons for including it in the P2Y receptor family as the P2Y(14) receptor.

AA Sequence

MINSTSTQPPDESCSQNLLITQQIIPVLYCMVFIAGILLNGVSGWIFFYVPSSKSFIIYLKNIVIADFVM      1 - 70
SLTFPFKILGDSGLGPWQLNVFVCRVSAVLFYVNMYVSIVFFGLISFDRYYKIVKPLWTSFIQSVSYSKL     71 - 140
LSVIVWMLMLLLAVPNIILTNQSVREVTQIKCIELKSELGRKWHKASNYIFVAIFWIVFLLLIVFYTAIT    141 - 210
KKIFKSHLKSSRNSTSVKKKSSRNIFSIVFVFFVCFVPYHIARIPYTKSQTEAHYSCQSKEILRYMKEFT    211 - 280
LLLSAANVCLDPIIYFFLCQPFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL                281 - 338
//

Text Mined References (35)

PMID Year Title
25130324 2014 A genome-wide search for quantitative trait loci affecting the cortical surface area and thickness of Heschl's gyrus.
24847057 2014 Extracellular UDP-glucose activates P2Y14 Receptor and Induces Signal Transducer and Activator of Transcription 3 (STAT3) Tyr705 phosphorylation and binding to hyaluronan synthase 2 (HAS2) promoter, stimulating hyaluronan synthesis of keratinocytes.
23592514 2013 A selective high-affinity antagonist of the P2Y14 receptor inhibits UDP-glucose-stimulated chemotaxis of human neutrophils.
22673622 2012 The UDP-sugar-sensing P2Y(14) receptor promotes Rho-mediated signaling and chemotaxis in human neutrophils.
19454705 2009 The UDP-glucose receptor P2RY14 triggers innate mucosal immunity in the female reproductive tract by inducing IL-8.
18690346 2008 Detection of P2Y(14) protein in platelets and investigation of the role of P2Y(14) in platelet function in comparison with the EP(3) receptor.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17088057 2007 Molecular dynamics simulation of the P2Y14 receptor. Ligand docking and identification of a putative binding site of the distal hexose moiety.
17016747 Defining the nucleotide binding sites of P2Y receptors using rhodopsin-based homology modeling.
More...