Property Summary

NCBI Gene PubMed Count 34
PubMed Score 47.35
PubTator Score 55.69

Knowledge Summary

Patent (5,467)

Expression

  Differential Expression (27)

Gene RIF (9)

AA Sequence

MINSTSTQPPDESCSQNLLITQQIIPVLYCMVFIAGILLNGVSGWIFFYVPSSKSFIIYLKNIVIADFVM      1 - 70
SLTFPFKILGDSGLGPWQLNVFVCRVSAVLFYVNMYVSIVFFGLISFDRYYKIVKPLWTSFIQSVSYSKL     71 - 140
LSVIVWMLMLLLAVPNIILTNQSVREVTQIKCIELKSELGRKWHKASNYIFVAIFWIVFLLLIVFYTAIT    141 - 210
KKIFKSHLKSSRNSTSVKKKSSRNIFSIVFVFFVCFVPYHIARIPYTKSQTEAHYSCQSKEILRYMKEFT    211 - 280
LLLSAANVCLDPIIYFFLCQPFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL                281 - 338
//

Text Mined References (35)

PMID Year Title