Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.69
PubTator Score 2.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
aldosterone-producing adenoma -1.241 4.9e-02
atypical teratoid / rhabdoid tumor 1.500 3.4e-07
breast carcinoma 1.300 3.4e-18
glioblastoma 1.400 9.5e-05
group 3 medulloblastoma 1.600 1.1e-04
invasive ductal carcinoma 1.100 6.1e-03
lung adenocarcinoma 1.248 9.9e-06
lung cancer 1.600 6.6e-03
malignant mesothelioma 1.100 5.1e-05
medulloblastoma, large-cell 1.900 1.4e-04
non-small cell lung cancer 1.602 3.2e-21
pediatric high grade glioma 1.100 1.1e-04
primitive neuroectodermal tumor 1.800 5.9e-04
spina bifida -1.080 4.0e-02

Gene RIF (4)

AA Sequence

MLGWIKRLIRMVFQQVGVSMQSVLWSRKPYGSSRSIVRKIGTNLSLIQCPRVQFQINSHATEWSPSHPGE      1 - 70
DAVASFADVGWVAKEEGECSARLRTEVRSRPPLQDDLLFFEKAPSRQISLPDLSQEEPQLKTPALANEEA     71 - 140
LQKICALENELAALRAQIAKIVTQQEQQNLTAGDLDSTTFGTIPPHPPPPPPPLPPPALGLHQSTSAVDL    141 - 210
IKERREKRANAGKTLVKNNPKKPEMPNMLEILKEMNSVKLRSVKRSEQDVKPKPVDATDPAALIAEALKK    211 - 280
KFAYRYRSDSQDEVEKGIPKSESEATSERVLFGPHMLKPTGKMKALIENVSDS                     281 - 333
//

Text Mined References (16)

PMID Year Title