Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.66
PubTator Score 2.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 3.19545927953064E-21
breast carcinoma 1614 3.44210666110612E-18
atypical teratoid / rhabdoid tumor 4369 3.35400475631505E-7
lung adenocarcinoma 2714 9.8692470987783E-6
malignant mesothelioma 3163 5.13984241494809E-5
glioblastoma 5572 9.51718649881136E-5
group 3 medulloblastoma 2254 1.10317743939421E-4
pediatric high grade glioma 2712 1.14937481562404E-4
medulloblastoma, large-cell 6234 1.36404749021209E-4
lung cancer 4473 2.13780655557923E-4
primitive neuroectodermal tumor 3031 5.92081986520755E-4
invasive ductal carcinoma 2950 0.00614934794401277
spina bifida 1064 0.0397774482546846
aldosterone-producing adenoma 664 0.0491256672517182

Expression

  Differential Expression (14)

Synonym

Accession Q15390 E7EP84 Q6IB94 Q7Z669 Q86XH5 Q8IVD7
Symbols CHPPR
FAM54A2

Gene

  Ortholog (11)

Gene RIF (4)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
17709566 reports the role of mouse Mtfr1 in protecting cells from reactive oxygen species using Mtfr1-deficient mice.
15389597 reports full-length mRNA sequence of human MTFR1.
12359332 presents partial sequence of a human homolog of chicken MTFR1

AA Sequence

MLGWIKRLIRMVFQQVGVSMQSVLWSRKPYGSSRSIVRKIGTNLSLIQCPRVQFQINSHATEWSPSHPGE      1 - 70
DAVASFADVGWVAKEEGECSARLRTEVRSRPPLQDDLLFFEKAPSRQISLPDLSQEEPQLKTPALANEEA     71 - 140
LQKICALENELAALRAQIAKIVTQQEQQNLTAGDLDSTTFGTIPPHPPPPPPPLPPPALGLHQSTSAVDL    141 - 210
IKERREKRANAGKTLVKNNPKKPEMPNMLEILKEMNSVKLRSVKRSEQDVKPKPVDATDPAALIAEALKK    211 - 280
KFAYRYRSDSQDEVEKGIPKSESEATSERVLFGPHMLKPTGKMKALIENVSDS                     281 - 333
//

Text Mined References (16)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17709566 2007 Impaired expression of genes coding for reactive oxygen species scavenging enzymes in testes of Mtfr1/Chppr-deficient mice.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...