Property Summary

NCBI Gene PubMed Count 248
PubMed Score 709.48
PubTator Score 543.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Fibrosis 40
Inflammation 109
Sepsis 21
Disease Target Count P-value
non-small cell lung cancer 2798 9.36220109736399E-23
lung adenocarcinoma 2714 3.67654956122931E-19
lung carcinoma 2844 2.65211603207245E-17
pituitary cancer 1972 5.66402581603701E-14
posterior fossa group B ependymoma 1530 1.4869248286728E-10
malignant mesothelioma 3163 1.03453534686722E-9
cystic fibrosis 1670 1.36114376100345E-5
lung cancer 4473 2.91615653547966E-5
ductal carcinoma in situ 1745 2.03088910764482E-4
breast carcinoma 1614 2.17393715246926E-4
invasive ductal carcinoma 2950 3.95852617584318E-4
adult high grade glioma 2148 0.00178843001271042
osteosarcoma 7933 0.00207693045466687
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00563874451782061
glioblastoma 5572 0.0154718700735013
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0251269236654967
colon cancer 1475 0.0280551569993054
ovarian cancer 8492 0.0446099023847093
Breast cancer 3099 0.0462553075012919
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma -5.400 0.000
osteosarcoma 3.220 0.002
posterior fossa group B ependymoma 3.500 0.000
glioblastoma 1.200 0.015
cystic fibrosis 1.388 0.000
non-small cell lung cancer -2.643 0.000
intraductal papillary-mucinous carcinoma... -1.700 0.025
intraductal papillary-mucinous neoplasm ... -2.400 0.006
lung cancer -3.600 0.000
colon cancer -1.100 0.028
breast carcinoma -1.900 0.000
lung adenocarcinoma -2.400 0.000
adult high grade glioma 1.800 0.002
Breast cancer 1.500 0.046
lung carcinoma -2.300 0.000
ductal carcinoma in situ -3.000 0.000
invasive ductal carcinoma -3.500 0.000
ovarian cancer -1.100 0.045
pituitary cancer -3.300 0.000

Synonym

Accession Q15389 Q5HYA0 ANG-1
Symbols AGP1
AGPT
ANG1

Gene

PANTHER Protein Class (1)

PDB

4K0V   4EPU   4JYO  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (218)

PMID Text
26908325 AGP1 is downregulated in non-small cell lung cancer patients compared to those with benign lung disease or no lung disease.
26722421 ANGPT1 may be associated with taxol resistance of nasopharyngeal carcinoma cells.
26542693 Genetic variations of ANGPT1 were associated with increased infarct size and disease susceptibility.
26489624 ANGPT1, ANGPT2, and VEGF are associated with development of acute graft-versus-host disease after allogeneic hematopoietic stem cell transplantation.
26283334 Gingipains from the Porphyromonas gingivalis play roles in regulation of angiopoietin 1 and angiopoietin 2 in human aortic smooth muscle cells.
26208799 In this study found that serum Ang-1 levels were significantly higher at 72 hours post-hemorrhage among aSAH patients.
26138305 For the diagnosis of HELLP syndrome, increased levels of ET-1,M30 and Angs-1 [Angiopoietin-1] and -2 [Angiopoietin-2]appear as promising biomarkers after determination of their standardized threshold levels
26090803 Malaria in pregnancy is an effect modifier of the association between Ang-1 and placental barrier thickness.
26090670 Angiopoietin-1 Regulates Brain Endothelial Permeability through PTPN-2 Mediated Tyrosine Dephosphorylation of Occludin
26044849 ANGPT1 plays a significant role in the prognosis in patients diagnosed with oral squamous cell cancer.
More...

AA Sequence

MTVFLSFAFLAAILTHIGCSNQRRSPENSGRRYNRIQHGQCAYTFILPEHDGNCRESTTDQYNTNALQRD      1 - 70
APHVEPDFSSQKLQHLEHVMENYTQWLQKLENYIVENMKSEMAQIQQNAVQNHTATMLEIGTSLLSQTAE     71 - 140
QTRKLTDVETQVLNQTSRLEIQLLENSLSTYKLEKQLLQQTNEILKIHEKNSLLEHKILEMEGKHKEELD    141 - 210
TLKEEKENLQGLVTRQTYIIQELEKQLNRATTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEE    211 - 280
KPFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGN    281 - 350
PSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLIL    351 - 420
HGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTT    421 - 490
MMIRPLDF                                                                  491 - 498
//

Text Mined References (256)

PMID Year Title
26908325 2016 Identification of GlcNAcylated alpha-1-antichymotrypsin as an early biomarker in human non-small-cell lung cancer by quantitative proteomic analysis with two lectins.
26722421 2015 Amplification of chromosome 8q21-qter associated with the acquired paclitaxel resistance of nasopharyngeal carcinoma cells.
26542693 2015 Integrative Mouse and Human Studies Implicate ANGPT1 and ZBTB7C as Susceptibility Genes to Ischemic Injury.
26489624 2015 Angiogenic factors are associated with development of acute graft-versus-host disease after allogeneic hematopoietic stem cell transplantation.
26283334 2015 Gingipains from the Periodontal Pathogen Porphyromonas gingivalis Play a Significant Role in Regulation of Angiopoietin 1 and Angiopoietin 2 in Human Aortic Smooth Muscle Cells.
26208799 2015 High Angiopoietin-1 levels predict a good functional outcome within 72 h of an aneurysmal subarachnoid hemorrhage: A prospective study from a single center.
26138305 2016 Serum levels of ET-1, M30, and angiopoietins-1 and -2 in HELLP syndrome and preeclampsia compared to controls.
26090803 2015 Malaria in Pregnancy Interacts with and Alters the Angiogenic Profiles of the Placenta.
26090670 2015 Angiopoietin-1 Regulates Brain Endothelial Permeability through PTPN-2 Mediated Tyrosine Dephosphorylation of Occludin.
26044849 2015 Analysis of angiogenic markers in oral squamous cell carcinoma-gene and protein expression.
More...