Property Summary

NCBI Gene PubMed Count 277
PubMed Score 755.42
PubTator Score 543.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma 1.800 1.8e-03
Breast cancer 1.400 4.0e-02
breast carcinoma -1.900 2.2e-04
colon cancer -1.100 2.8e-02
cystic fibrosis 1.388 1.4e-05
ductal carcinoma in situ -2.100 8.0e-05
ependymoma 2.300 5.8e-06
glioblastoma 1.200 1.5e-02
intraductal papillary-mucinous carcinoma... -1.700 2.5e-02
intraductal papillary-mucinous neoplasm ... -1.500 5.4e-03
invasive ductal carcinoma -1.900 1.6e-03
lung adenocarcinoma -1.600 2.8e-13
lung cancer -1.500 2.5e-02
lung carcinoma -2.300 2.7e-17
malignant mesothelioma -4.500 3.4e-08
non-small cell lung cancer -2.225 1.4e-19
osteosarcoma 3.220 2.1e-03
ovarian cancer -1.100 4.5e-02
pituitary cancer -3.200 9.4e-09

Protein-protein Interaction (1)

Gene RIF (247)

AA Sequence

MTVFLSFAFLAAILTHIGCSNQRRSPENSGRRYNRIQHGQCAYTFILPEHDGNCRESTTDQYNTNALQRD      1 - 70
APHVEPDFSSQKLQHLEHVMENYTQWLQKLENYIVENMKSEMAQIQQNAVQNHTATMLEIGTSLLSQTAE     71 - 140
QTRKLTDVETQVLNQTSRLEIQLLENSLSTYKLEKQLLQQTNEILKIHEKNSLLEHKILEMEGKHKEELD    141 - 210
TLKEEKENLQGLVTRQTYIIQELEKQLNRATTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEE    211 - 280
KPFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGN    281 - 350
PSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLIL    351 - 420
HGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTT    421 - 490
MMIRPLDF                                                                  491 - 498
//

Text Mined References (285)

PMID Year Title