Property Summary

NCBI Gene PubMed Count 35
Grant Count 13
R01 Count 1
Funding $1,660,999.73
PubMed Score 145.21
PubTator Score 88.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 2.245 0.000
psoriasis -1.300 0.000
posterior fossa group B ependymoma -1.300 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.100 0.001
lung cancer 1.100 0.010
ovarian cancer -1.900 0.000

Gene RIF (6)

PMID Text
26615136 TOMM20 protein is highly expressed in both anaplastic thyroid cancer and papillary thyroid cancer compared to non-cancerous thyroid tissue.
23165776 Tom20 was ubiquitously distributed in the organ of Corti, allowing well-delineated visualization of inner and outer hair cells. In the inner ear of aged subjects with Meniere's disease, there was decreased expression of Tom20.
21771790 a novel model in which Tom20 binds Tom70 to facilitate preprotein release from the chaperones by competition
20877624 Observational study of gene-disease association. (HuGE Navigator)
14699115 the cytosolic domains of Tom20 and Tom22 function to maintain their substrate preproteins unfolded and prevent them from aggregating on the mitochondrial surface
11913975 Tom34 unlike Tom20 does not interact with the leader sequences of mitochondrial precursor proteins

AA Sequence

MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFF      1 - 70
LEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLA     71 - 140
EDDVE                                                                     141 - 145
//

Text Mined References (49)

PMID Year Title
26615136 2015 Mitochondrial Metabolism as a Treatment Target in Anaplastic Thyroid Cancer.
25997101 2015 QIL1 is a novel mitochondrial protein required for MICOS complex stability and cristae morphology.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25764979 2015 The non-glycosylated isoform of MIC26 is a constituent of the mammalian MICOS complex and promotes formation of crista junctions.
25621951 2015 USP30 and parkin homeostatically regulate atypical ubiquitin chains on mitochondria.
25327288 2014 Selective VPS34 inhibitor blocks autophagy and uncovers a role for NCOA4 in ferritin degradation and iron homeostasis in vivo.
24896179 2014 The mitochondrial deubiquitinase USP30 opposes parkin-mediated mitophagy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23455425 2013 Autophagosomes form at ER-mitochondria contact sites.
More...