Property Summary

NCBI Gene PubMed Count 38
PubMed Score 151.71
PubTator Score 88.48

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 1.2e-04
ependymoma -1.100 1.1e-08
glioblastoma -1.100 6.0e-04
lung cancer 1.100 1.0e-02
Multiple myeloma 2.245 2.1e-04
ovarian cancer -1.900 5.8e-05
psoriasis -1.300 4.2e-04

Gene RIF (11)

AA Sequence

MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFF      1 - 70
LEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLA     71 - 140
EDDVE                                                                     141 - 145
//

Text Mined References (52)

PMID Year Title