Property Summary

NCBI Gene PubMed Count 21
PubMed Score 12.75
PubTator Score 13.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 1.892 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
glioblastoma 1.900 0.000
group 4 medulloblastoma 1.800 0.000
medulloblastoma, large-cell 2.100 0.000
lung cancer 1.200 0.020
diabetes mellitus 2.000 0.002
pediatric high grade glioma 1.400 0.001
psoriasis 1.100 0.000
ovarian cancer 2.600 0.000

Synonym

Accession Q15386 A4D235 A6NCP3 Q8TC15 Q96CR4 Q9UDU3
Symbols HECTH2

Gene

PANTHER Protein Class (2)

 GWAS Trait (1)

Gene RIF (12)

PMID Text
26067607 data reveal that high UBE3C expression contributes to glioma progression by ubiquitination and degradation of ANXA7, and thus presents a novel and promising target for glioma therapy.
25658088 these observations suggest that UBE3C plays an important role in RCC development and progression, and UBE3C may be a novel target for prevention and treatment of ccRCC.
24425307 UBE3C is a mutant candidate oncogene involved in tumor development and progression of hepatocellular carcinoma.
24158444 knockdown renders cells more susceptible to the Hsp90 inhibitor 17-AAG, suggesting that UBE3C protects against the harmful accumulation of protein fragments arising from incompletely degraded proteasome substrates.
21881582 Our findings provide evidence that variations in UBE3C are potent genetic markers of nasal polyps development in Korean asthmatics.
21167755 negatively regulates type I interferon through ubiquitination of the transcription factors
20934631 gene polymorphism is associated with the risk of Aspirin-intolerant asthma
20934631 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MFSFEGDFKTRPKVSLGGASRKEEKASLLHRTQEERRKREEERRRLKNAIIIQSFIRGYRDRKQQYSIQR      1 - 70
SAFDRCATLSQSGGAFPIANGPNLTLLVRQLLFFYKQNEDSKRLIWLYQNLIKHSSLFVKQLDGSERLTC     71 - 140
LFQIKRLMSLCCRLLQNCNDDSLNVALPMRMLEVFSSENTYLPVLQDASYVVSVIEQILHYMIHNGYYRS    141 - 210
LYLLINSKLPSSIEYSDLSRVPIAKILLENVLKPLHFTYNSCPEGARQQVFTAFTEEFLAAPFTDQIFHF    211 - 280
IIPALADAQTVFPYEPFLNALLLIESRCSRKSGGAPWLFYFVLTVGENYLGALSEEGLLVYLRVLQTFLS    281 - 350
QLPVSPASASCHDSASDSEEESEEADKPSSPEDGRLSVSYITEECLKKLDTKQQTNTLLNLVWRDSASEE    351 - 420
VFTTMASVCHTLMVQHRMMVPKVRLLYSLAFNARFLRHLWFLISSMSTRMITGSMVPLLQVISRGSPMSF    421 - 490
EDSSRIIPLFYLFSSLFSHSLISIHDNEFFGDPIEVVGQRQSSMMPFTLEELIMLSRCLRDACLGIIKLA    491 - 560
YPETKPEVREEYITAFQSIGVTTSSEMQQCIQMEQKRWIQLFKVITNLVKMLKSRDTRRNFCPPNHWLSE    561 - 630
QEDIKADKVTQLYVPASRHVWRFRRMGRIGPLQSTLDVGLESPPLSVSEERQLAVLTELPFVVPFEERVK    631 - 700
IFQRLIYADKQEVQGDGPFLDGINVTIRRNYIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGG    701 - 770
GIFREFLNELLKSGFNPNQGFFKTTNEGLLYPNPAAQMLVGDSFARHYYFLGRMLGKALYENMLVELPFA    771 - 840
GFFLSKLLGTSADVDIHHLASLDPEVYKNLLFLKSYEDDVEELGLNFTVVNNDLGEAQVVELKFGGKDIP    841 - 910
VTSANRIAYIHLVADYRLNRQIRQHCLAFRQGLANVVSLEWLRMFDQQEIQVLISGAQVPISLEDLKSFT    911 - 980
NYSGGYSADHPVIKVFWRVVEGFTDEEKRKLLKFVTSCSRPPLLGFKELYPAFCIHNGGSDLERLPTAST    981 - 1050
CMNLLKLPEFYDETLLRSKLLYAIECAAGFELS                                        1051 - 1083
//

Text Mined References (26)

PMID Year Title
26067607 2015 Ubiquitin-protein ligase E3C promotes glioma progression by mediating the ubiquitination and degrading of Annexin A7.
25658088 2015 UBE3C promotes growth and metastasis of renal cell carcinoma via activating Wnt/?-catenin pathway.
25416956 2014 A proteome-scale map of the human interactome network.
24425307 2014 Clinical significance of the ubiquitin ligase UBE3C in hepatocellular carcinoma revealed by exome sequencing.
24158444 2013 The E3 ubiquitin ligase UBE3C enhances proteasome processivity by ubiquitinating partially proteolyzed substrates.
21881582 2011 UBE3C genetic variations as potent markers of nasal polyps in Korean asthma patients.
21269460 2011 Initial characterization of the human central proteome.
21167755 2010 The ubiquitin E3 ligase RAUL negatively regulates type i interferon through ubiquitination of the transcription factors IRF7 and IRF3.
20934631 2010 Association analysis of UBE3C polymorphisms in Korean aspirin-intolerant asthmatic patients.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...