Property Summary

NCBI Gene PubMed Count 23
PubMed Score 14.09
PubTator Score 13.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Arthritis, Juvenile 126 0.0 0.0
Disease Target Count
Juvenile arthritis 126
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Cocaine Dependence 51 3.021 1.5

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 1.5e-04
diabetes mellitus 2.000 1.6e-03
glioblastoma 1.900 4.6e-04
group 4 medulloblastoma 1.800 2.3e-04
lung cancer 1.200 2.0e-02
medulloblastoma, large-cell 2.100 7.6e-05
osteosarcoma -1.253 6.1e-04
ovarian cancer 2.600 7.0e-05
pediatric high grade glioma 1.400 5.1e-04
psoriasis 1.100 1.0e-07

Gene RIF (14)

AA Sequence

MFSFEGDFKTRPKVSLGGASRKEEKASLLHRTQEERRKREEERRRLKNAIIIQSFIRGYRDRKQQYSIQR      1 - 70
SAFDRCATLSQSGGAFPIANGPNLTLLVRQLLFFYKQNEDSKRLIWLYQNLIKHSSLFVKQLDGSERLTC     71 - 140
LFQIKRLMSLCCRLLQNCNDDSLNVALPMRMLEVFSSENTYLPVLQDASYVVSVIEQILHYMIHNGYYRS    141 - 210
LYLLINSKLPSSIEYSDLSRVPIAKILLENVLKPLHFTYNSCPEGARQQVFTAFTEEFLAAPFTDQIFHF    211 - 280
IIPALADAQTVFPYEPFLNALLLIESRCSRKSGGAPWLFYFVLTVGENYLGALSEEGLLVYLRVLQTFLS    281 - 350
QLPVSPASASCHDSASDSEEESEEADKPSSPEDGRLSVSYITEECLKKLDTKQQTNTLLNLVWRDSASEE    351 - 420
VFTTMASVCHTLMVQHRMMVPKVRLLYSLAFNARFLRHLWFLISSMSTRMITGSMVPLLQVISRGSPMSF    421 - 490
EDSSRIIPLFYLFSSLFSHSLISIHDNEFFGDPIEVVGQRQSSMMPFTLEELIMLSRCLRDACLGIIKLA    491 - 560
YPETKPEVREEYITAFQSIGVTTSSEMQQCIQMEQKRWIQLFKVITNLVKMLKSRDTRRNFCPPNHWLSE    561 - 630
QEDIKADKVTQLYVPASRHVWRFRRMGRIGPLQSTLDVGLESPPLSVSEERQLAVLTELPFVVPFEERVK    631 - 700
IFQRLIYADKQEVQGDGPFLDGINVTIRRNYIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGG    701 - 770
GIFREFLNELLKSGFNPNQGFFKTTNEGLLYPNPAAQMLVGDSFARHYYFLGRMLGKALYENMLVELPFA    771 - 840
GFFLSKLLGTSADVDIHHLASLDPEVYKNLLFLKSYEDDVEELGLNFTVVNNDLGEAQVVELKFGGKDIP    841 - 910
VTSANRIAYIHLVADYRLNRQIRQHCLAFRQGLANVVSLEWLRMFDQQEIQVLISGAQVPISLEDLKSFT    911 - 980
NYSGGYSADHPVIKVFWRVVEGFTDEEKRKLLKFVTSCSRPPLLGFKELYPAFCIHNGGSDLERLPTAST    981 - 1050
CMNLLKLPEFYDETLLRSKLLYAIECAAGFELS                                        1051 - 1083
//

Text Mined References (28)

PMID Year Title