Property Summary

NCBI Gene PubMed Count 88
Grant Count 232
R01 Count 169
Funding $19,898,220.76
PubMed Score 190.13
PubTator Score 134.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
adult high grade glioma -1.300 0.005
group 3 medulloblastoma 1.200 0.040

Synonym

Accession Q15382 B3KWN6 D3DX13 Q53Y56 Q99444
Symbols RHEB2

Gene

PDB

3T5G   1XTQ   1XTR   1XTS   3SEA  

Gene RIF (60)

PMID Text
26742086 By interfering with TSC-Rheb complex, arginine relieves allosteric inhibition of Rheb by TSC. Arginine cooperates with growth factor signaling which further promotes dissociation of TSC2 from lysosomes and activation of mTORC1.
26319900 RGS10 could serve in a novel, and previously unknown, role by accelerating the hydrolysis of GTP from Rheb in ovarian cancer cells.
26255626 Mutations in the TSC2-RHEB-mTOR signaling axis may lead to a loss of inhibitory inputs thus conferring a survival advantage to a dividing tumor cell.
25799580 Activation of CNTF/CNTFRalpha signaling pathway by hRheb(S16H) transduction of dopaminergic neurons
25594310 Data show that Rheb/p27 axis induces autophagy-dependent cancer cell survival under stress conditions.
25476905 In TSC2-deficient angiomyolipoma patient cells, IRF7 is a pivotal factor in the Rheb/mTOR pathway.
25422319 These results establish CAD as a downstream effector of Rheb and suggest a possible role of Rheb in regulating de novo pyrimidine nucleotide synthesis.(Rheb small GTPases, which consist of Rheb1 and Rheb2 (also known as RhebL1)
24648513 Data indicate that Rheb G63A stimulated phosphorylation of the mTORC1 substrate p70S6 kinase more strongly than wild-type, thus offering a new tool for mammalian target of rapamycin (mTOR) signaling.
24403554 In vitro data indicated that miR-155 suppressed the macrophage-mediated bacterial phagocytosis and intracellular killing of Pseudomonas aeruginosa by targeting Rheb (Ras homolog enriched in brain).
24368770 study defines Rheb as a novel physiological regulator of BACE1 levels and Abeta generation, and the Rheb-BACE1 circuitry may have a role in brain biology and disease.
More...

AA Sequence

MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIF      1 - 70
PQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAES     71 - 140
WNAAFLESSAKENQTAVDVFRRIILEAEKMDGAASQGKSSCSVM                              141 - 184
//

Text Mined References (92)

PMID Year Title
26742086 2016 Control of TSC2-Rheb signaling axis by arginine regulates mTORC1 activity.
26319900 2015 Suppression of the GTPase-activating protein RGS10 increases Rheb-GTP and mTOR signaling in ovarian cancer cells.
26255626 2015 Point mutations of the mTOR-RHEB pathway in renal cell carcinoma.
25799580 2015 Activation of CNTF/CNTFR? signaling pathway by hRheb(S16H) transduction of dopaminergic neurons in vivo.
25594310 2016 Rheb promotes cancer cell survival through p27Kip1-dependent activation of autophagy.
25476905 2014 Analysis of gene expression array in TSC2-deficient AML cells reveals IRF7 as a pivotal factor in the Rheb/mTOR pathway.
25422319 2015 Rheb protein binds CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamoylase, and dihydroorotase) protein in a GTP- and effector domain-dependent manner and influences its cellular localization and carbamoyl-phosphate synthetase (CPSase) activity.
24648513 2014 Structure-guided mutation of the conserved G3-box glycine in Rheb generates a constitutively activated regulator of mammalian target of rapamycin (mTOR).
24403554 2014 miR-155 suppresses bacterial clearance in Pseudomonas aeruginosa-induced keratitis by targeting Rheb.
24368770 2014 Rheb GTPase regulates ?-secretase levels and amyloid ? generation.
More...