Property Summary

NCBI Gene PubMed Count 43
PubMed Score 64.82
PubTator Score 44.93

Knowledge Summary

Patent (11,737)

TINX Plot

  Disease Sources (4)

Disease Target Count
Small cell carcinoma of lung 45
Disease Target Count P-value
colon cancer 1475 3.17239917103985E-11
Breast cancer 3099 9.23355294865316E-11
lung cancer 4473 8.70154753363862E-7
lung carcinoma 2844 4.02000805889622E-6
group 4 medulloblastoma 1875 1.205973578151E-5
medulloblastoma, large-cell 6234 4.58178544597736E-5
pilocytic astrocytoma 3086 4.68744497638903E-5
glioblastoma 5572 1.10268792993307E-4
pediatric high grade glioma 2712 2.03335785081672E-4
pituitary cancer 1972 2.69143666691174E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00108703588953382
head and neck cancer and chronic obstructive pulmonary disease 237 0.0049844853749431
astrocytic glioma 2241 0.00689472690856128
oligodendroglioma 2849 0.019823731134493
interstitial cystitis 2299 0.0260277877971242
subependymal giant cell astrocytoma 2287 0.0334999632536946
Disease Target Count Z-score Confidence
Kidney disease 397 0.0 1.0

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.300 0.007
oligodendroglioma -1.600 0.020
glioblastoma -2.800 0.000
group 4 medulloblastoma -2.400 0.000
medulloblastoma, large-cell 3.800 0.000
intraductal papillary-mucinous adenoma (... -1.200 0.001
lung cancer 4.600 0.000
colon cancer -3.500 0.000
interstitial cystitis -1.400 0.026
pediatric high grade glioma -2.100 0.000
pilocytic astrocytoma -2.400 0.000
subependymal giant cell astrocytoma -1.830 0.033
lung carcinoma 1.500 0.000
Breast cancer -1.800 0.000
pituitary cancer 1.900 0.000
head and neck cancer and chronic obstruc... -1.100 0.005

Synonym

Accession Q15375 A0AUX7 B2R8W1 B7ZLJ9 B7ZLK0 Q59G40 Q5VTU0 Q8N368 Q9H124
Symbols EHK3
EK11
EHK-3
HEK11

Gene

PDB

2REI   3DKO   3H8M   3NRU  

  Ortholog (13)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (18)

PMID Text
25968442 Depletion of EphA7 remarkably inhibited the proliferation and invasion of Hep-2 and AMC-HN-8 cells in comparison to control and EphA7 siRNA negative control (NC)-transfected cells.
25855521 Authors observed that the extracellular region of the EphA7 receptor was critical for interacting with caspase-8, whereas the cytoplasmic region of EphA7 was not.
24927112 miR-137 is able to directly bind to the EPHA7 3'UTR and negatively regulate the expression of EPHA7 in HUVECs.
22246354 Overexpression of EphA7 and/or MTDH might indicate poor prognosis in squamous cell cancer of the tongue.
22036564 EPHA7 acts as a tumor suppressor in vivo and is targeted by genomic deletions and differential epigenetic silencing in human lymphomas.
21964981 MTDH and EphA7 are markers for metastasis and poor prognosis of gallbladder adenocarcinoma.
21935409 Data found significant correlations between ephA2, ephA4, ephA7, ephB4, and ephB6 and overall and/or recurrence-free survival in large microarray datasets.
21609571 The expression of EphA7 and/or MTDH might be closely related to the carcinogenesis, progression, clinical biological behaviors and prognosis of gallbladder adenocarcinoma.
21124932 Data shew that the identification of three novel candidates as EPH receptor genes might indicate a link between perturbed compartmentalization of early neoplastic lesions and breast cancer risk and progression.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MVFQTRYPSWIILCYIWLLRFAHTGEAQAAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRT      1 - 70
YQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRE     71 - 140
NLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIE    141 - 210
NLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCG    211 - 280
RGFYKSSSQDLQCSRCPTHSFSDKEGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLE    281 - 350
WSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNG    351 - 420
VSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKYYEKDQRERTY    421 - 490
STVKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEATGKMFEATAVSSEQNPVIIIAV    491 - 560
VAVAGTIILVFMVFGFIIGRRHCGYSKADQEGDEELYFHFKFPGTKTYIDPETYEDPNRAVHQFAKELDA    561 - 630
SCIKIERVIGAGEFGEVCSGRLKLPGKRDVAVAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGV    631 - 700
VTRGKPVMIVIEFMENGALDAFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNL    701 - 770
VCKVSDFGLSRVIEDDPEAVYTTTGGKIPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDM    771 - 840
SNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGILDKMIRNPNSLKTPLGTCSRP    841 - 910
ISPLLDQNTPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTIEDVMSLGITLVGHQKKIMSS    911 - 980
IQTMRAQMLHLHGTGIQV                                                        981 - 998
//

Text Mined References (46)

PMID Year Title
25968442 2015 Effect of EphA7 Silencing on Proliferation, Invasion and Apoptosis in Human Laryngeal Cancer Cell Lines Hep-2 and AMC-HN-8.
25855521 2015 EphA receptors form a complex with caspase-8 to induce apoptotic cell death.
25194280 2014 Genome-wide association study identifies three susceptibility loci for laryngeal squamous cell carcinoma in the Chinese population.
24927112 2014 miR-137 regulates the migration of human umbilical vein endothelial cells by targeting ephrin-type A receptor 7.
24483146 2014 Discovery of genetic biomarkers contributing to variation in drug response of cytidine analogues using human lymphoblastoid cell lines.
22246354 2011 [Expression of EphA7 and MTDH and clinicopathological significance in the squamous cell cancer of the tongue].
22095909 2012 Serum ferritin levels are associated with a distinct phenotype of chronic hepatitis C poorly responding to pegylated interferon-alpha and ribavirin therapy.
22036564 2011 The Eph-receptor A7 is a soluble tumor suppressor for follicular lymphoma.
21964981 2013 MTDH and EphA7 are markers for metastasis and poor prognosis of gallbladder adenocarcinoma.
21935409 2011 Eph/ephrin profiling in human breast cancer reveals significant associations between expression level and clinical outcome.
More...