Property Summary

NCBI Gene PubMed Count 57
PubMed Score 35.13
PubTator Score 60.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 6.4e-05
diabetes mellitus 1728 1.5e-03
Multiple myeloma 1332 1.8e-03
Waldenstrons macroglobulinemia 765 1.7e-02
acute myeloid leukemia 783 4.2e-02
Disease Target Count Z-score Confidence
Hemangioma 69 3.819 1.9
Cancer 2499 3.02 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
acute myeloid leukemia -1.200 4.2e-02
diabetes mellitus -1.700 1.5e-03
Multiple myeloma 1.342 1.8e-03
ovarian cancer 2.100 6.4e-05
Waldenstrons macroglobulinemia 1.178 1.7e-02

Protein-protein Interaction (1)

PDB (45)

Gene RIF (50)

AA Sequence

MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQ      1 - 70
APATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ                           71 - 118
//

Text Mined References (65)

PMID Year Title