Property Summary

NCBI Gene PubMed Count 57
Grant Count 57
R01 Count 33
Funding $2,999,030.57
PubMed Score 36.69
PubTator Score 60.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.178 0.017
Multiple myeloma 1.342 0.002
diabetes mellitus -2.500 0.002
acute myeloid leukemia -1.200 0.042
ovarian cancer 2.100 0.000

Synonym

Accession Q15370 B7WPD3
Symbols SIII
TCEB2

Gene

PDB

2IZV   4WQO   1LM8   1LQB   1VCB   3ZRC   3ZRF   3ZTC   3ZTD   3ZUN   4AJY   4AWJ   4B95   4B9K   4BKS   4BKT   4W9C   4W9D   4W9E   4W9F   4W9G   4W9H   4W9I   4W9J   4W9K   4W9L   4N9F   2C9W   5BO4   3ZKJ   3ZNG   2MA9   3DCG   2JZ3  

Gene RIF (69)

PMID Text
26531153 Study shows that TCEB2 is involved in the development of acquired resistance to bevacizumab in ovarian cancer cells via the mechanisms of suppression of VEGF-A expression by promoting HIF-1alpha degradation and induction of interleukin-8 (IL-8) expression.
26121586 crystals of SOCS2 in complex with its adaptor proteins, Elongin C and Elongin B, underwent a change in crystallographic parameters when treated with dimethyl sulfoxide during soaking experiments.
25981045 HIV-1 complexes with TCEB2 (ELOB)
25912140 HIV-1 complexes with TCEB2 (ELOB)
25912140 HIV-1 complexes with TCEB2 (ELOB)
25901786 HIV-1 complexes with TCEB2 (ELOB)
25901786 HIV-1 complexes with TCEB2 (ELOB)
25661653 The crystal structure of VHL bound to a Cul2 N-terminal domain, Elongin B, and Elongin C.
25408426 HIV-1 complexes with TCEB2 (ELOB)
25408426 HIV-1 complexes with TCEB2 (ELOB)
More...

AA Sequence

MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQ      1 - 70
APATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ                           71 - 118
//

Text Mined References (65)

PMID Year Title
26531153 2016 TCEB2 confers resistance to VEGF-targeted therapy in ovarian cancer.
26121586 2015 Serendipitous SAD Solution for DMSO-Soaked SOCS2-ElonginC-ElonginB Crystals Using Covalently Incorporated Dimethylarsenic: Insights into Substrate Receptor Conformational Flexibility in Cullin RING Ligases.
25661653 2015 Insights into Cullin-RING E3 ubiquitin ligase recruitment: structure of the VHL-EloBC-Cul2 complex.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23988114 2013 Interactions between HIV-1 Vif and human ElonginB-ElonginC are important for CBF-? binding to Vif.
23837592 2013 Multimeric complexes among ankyrin-repeat and SOCS-box protein 9 (ASB9), ElonginBC, and Cullin 5: insights into the structure and assembly of ECS-type Cullin-RING E3 ubiquitin ligases.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23102700 2012 The Kelch repeat protein KLHDC10 regulates oxidative stress-induced ASK1 activation by suppressing PP5.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...