Property Summary

NCBI Gene PubMed Count 68
Grant Count 110
R01 Count 66
Funding $7,383,818.5
PubMed Score 47.16
PubTator Score 20.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 2.221 0.000
astrocytoma -1.400 0.001
invasive ductal carcinoma 1.200 0.013
ovarian cancer 2.400 0.000
Breast cancer 1.200 0.000
dermatomyositis 1.100 0.007

Synonym

Accession Q15369 E5RGD9 Q567Q6
Symbols SIII
TCEB1

Gene

PANTHER Protein Class (1)

PDB

2IZV   4WQO   1LM8   1LQB   1VCB   3ZRC   3ZRF   3ZTC   3ZTD   3ZUN   4AJY   4AWJ   4B95   4B9K   4BKS   4BKT   4W9C   4W9D   4W9E   4W9F   4W9G   4W9H   4W9I   4W9J   4W9K   4W9L   4N9F   2C9W   5BO4   3ZKJ   3ZNG   2MA9   3DCG  

Gene RIF (86)

PMID Text
26241003 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
26121586 crystals of SOCS2 in complex with its adaptor proteins, Elongin C and Elongin B, underwent a change in crystallographic parameters when treated with dimethyl sulfoxide during soaking experiments.
25981045 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
25912140 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
25901786 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
25901786 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
25901786 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
25676555 TCEB1-mutated renal cell carcinoma is a distinct entity with recurrent hotspot mutations, specific copy number alterations, pathway activation, and characteristic morphological features.
25661653 The crystal structure of VHL bound to a Cul2 N-terminal domain, Elongin B, and Elongin C.
25408426 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
More...

AA Sequence

MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVL      1 - 70
SKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC                                 71 - 112
//

Text Mined References (78)

PMID Year Title
26121586 2015 Serendipitous SAD Solution for DMSO-Soaked SOCS2-ElonginC-ElonginB Crystals Using Covalently Incorporated Dimethylarsenic: Insights into Substrate Receptor Conformational Flexibility in Cullin RING Ligases.
25676555 2015 TCEB1-mutated renal cell carcinoma: a distinct genomic and morphological subtype.
25661653 2015 Insights into Cullin-RING E3 ubiquitin ligase recruitment: structure of the VHL-EloBC-Cul2 complex.
25416956 2014 A proteome-scale map of the human interactome network.
24367103 2014 AFF1 is a ubiquitous P-TEFb partner to enable Tat extraction of P-TEFb from 7SK snRNP and formation of SECs for HIV transactivation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23988114 2013 Interactions between HIV-1 Vif and human ElonginB-ElonginC are important for CBF-? binding to Vif.
23837592 2013 Multimeric complexes among ankyrin-repeat and SOCS-box protein 9 (ASB9), ElonginBC, and Cullin 5: insights into the structure and assembly of ECS-type Cullin-RING E3 ubiquitin ligases.
23563313 2013 CCDC22 deficiency in humans blunts activation of proinflammatory NF-?B signaling.
23460923 2013 PRAME is a golgi-targeted protein that associates with the Elongin BC complex and is upregulated by interferon-gamma and bacterial PAMPs.
More...