Property Summary

NCBI Gene PubMed Count 68
PubMed Score 49.53
PubTator Score 20.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma, Renal Cell 124 0.0 0.0
Disease Target Count
Renal Cell Carcinoma 214
Disease Target Count P-value
Breast cancer 3578 1.3e-05
Multiple myeloma 1332 2.7e-04
ovarian cancer 8520 3.1e-04
astrocytoma 1146 1.1e-03
dermatomyositis 966 7.3e-03
invasive ductal carcinoma 2951 1.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Hemangioma 69 3.987 2.0

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma -1.400 1.1e-03
Breast cancer 1.200 1.3e-05
dermatomyositis 1.100 7.3e-03
invasive ductal carcinoma 1.200 1.3e-02
Multiple myeloma 2.221 2.7e-04
ovarian cancer 2.400 3.1e-04

Synonym

Accession Q15369 E5RGD9 Q567Q6 EloC
Symbols SIII
TCEB1

Gene

PANTHER Protein Class (1)

PDB

2IZV   4WQO   5N4W   1LM8   1LQB   1VCB   3ZRC   3ZRF   3ZTC   3ZTD   3ZUN   4AJY   4AWJ   4B95   4B9K   4BKS   4BKT   4W9C   4W9D   4W9E   4W9F   4W9G   4W9H   4W9I   4W9J   4W9K   4W9L   5LLI   5NVV   5NVW   5NVX   5NVY   5NVZ   5NW0   5NW1   5NW2   5T35   4N9F   2C9W   5BO4   3ZKJ   3ZNG   2MA9   3DCG  

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

Protein-protein Interaction (4)

Gene RIF (57)

AA Sequence

MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVL      1 - 70
SKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC                                 71 - 112
//

Text Mined References (78)

PMID Year Title