Property Summary

NCBI Gene PubMed Count 22
PubMed Score 15.73
PubTator Score 2176.06

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q15363
Symbols p24
P24A
RNP24
p24b1
p24beta1

Gene

PDB

5AZW  

Gene RIF (5)

PMID Text
22212250 TMED2/p24beta1 is expressed in all gestational stages of human placentas and in choriocarcinoma cell lines.
21219331 Both p24A transmembrane protein and p23 are specific cargo receptors of G protein-coupled receptors (GPCR) and differentially regulate GPCR signaling in astrocytes.
20361938 These results suggest that p24A is the limiting factor in CaSR trafficking in the early secretory pathway, and that cycling between the ER and ERGIC protects CaSR from degradation.
18187620 Knockdown of transmembrane emp24 domain trafficking protein 2 (TMED2) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17693410 p24A is a regulator of signal-dependent trafficking that controls ARF1-dependent resensitization of PAR-2

AA Sequence

MVTLAELLVLLAALLATVSGYFVSIDAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVEITGPDNKGIY      1 - 70
KGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQDMETEAHQNKLEEMINELAVA     71 - 140
MTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVLVAMTLGQIYYLKRFFEVRRVV             141 - 201
//

Text Mined References (29)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22212250 2012 TMED2/p24?1 is expressed in all gestational stages of human placentas and in choriocarcinoma cell lines.
21269460 2011 Initial characterization of the human central proteome.
21219331 2011 Proteinase-activated receptors, nucleotide P2Y receptors, and ?-opioid receptor-1B are under the control of the type I transmembrane proteins p23 and p24A in post-Golgi trafficking.
20427317 2010 Selective export of human GPI-anchored proteins from the endoplasmic reticulum.
20361938 2010 The cargo receptor p24A facilitates calcium sensing receptor maturation and stabilization in the early secretory pathway.
18287528 2008 The cargo receptors Surf4, endoplasmic reticulum-Golgi intermediate compartment (ERGIC)-53, and p25 are required to maintain the architecture of ERGIC and Golgi.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...