Property Summary

NCBI Gene PubMed Count 23
PubMed Score 17.34
PubTator Score 2176.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute quadriplegic myopathy 1.039 5.8e-05
atypical teratoid/rhabdoid tumor 1.100 2.1e-02
Breast cancer 2.600 4.8e-02
breast carcinoma 1.300 2.0e-03
dermatomyositis -1.100 8.1e-04
ependymoma 1.300 4.2e-05
gastric cancer -1.100 3.4e-02
glioblastoma 1.100 2.4e-02
group 3 medulloblastoma 1.600 4.7e-02
head and neck cancer 1.300 1.1e-02
invasive ductal carcinoma 1.100 1.6e-02
lung adenocarcinoma 1.562 1.1e-03
medulloblastoma, large-cell 1.800 6.2e-04
Multiple myeloma 1.019 4.6e-03
non primary Sjogren syndrome sicca 1.200 1.3e-02
non-small cell lung cancer 1.055 1.7e-08
osteosarcoma 1.045 2.3e-03
pancreatic cancer -1.400 1.3e-02
pancreatic carcinoma -1.400 1.3e-02
pancreatic ductal adenocarcinoma liver m... -1.590 3.4e-02

 GWAS Trait (1)

Gene RIF (6)

AA Sequence

MVTLAELLVLLAALLATVSGYFVSIDAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVEITGPDNKGIY      1 - 70
KGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQDMETEAHQNKLEEMINELAVA     71 - 140
MTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVLVAMTLGQIYYLKRFFEVRRVV             141 - 201
//

Text Mined References (30)

PMID Year Title