Property Summary

NCBI Gene PubMed Count 25
Grant Count 124
R01 Count 82
Funding $12,761,765.55
PubMed Score 25.82
PubTator Score 452.92

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q15361 A1L160 Q4VXF3 Q58EY2 Q6P5T5 TTF-1
Symbols TTF-1
TTF-I

Gene

Gene RIF (9)

PMID Text
26905105 P-AKT and TTF-1 using IHC had statistically significant correlation with EGFR mutation with high negative predictive value
26823891 Case Report: KRAS mutation-positive bronchial surface epithelium type lung adenocarcinoma with strong expression of TTF-1.
26469326 CK7, TTF-1 and napsin A are predominantly expressed in primary lung adenocarcinoma patients, with CDX-2 being inconsistently expressed.
26281863 Immunohistochemical comparison of two TTF-1 mAbs in atypical squamous lesions and sarcomatoid carcinoma of the lung, and pleural malignant mesothelioma suggest possibility for diagnostic errors.
26036188 Overexpression of Transcription Termination Factor 1 is Associated with Colorectal Cancer
25982999 Low expression levels of TTF-1 is associated with lung adenocarcinoma.
25878335 Combined genomic and proteomic analyses demonstrated infrequent alteration of validated lung cancer targets but identified novel potential targets for TTF1-negative LUAD, including KEAP1/Nrf2 and DNA repair pathways
25722034 results indicate that TTF-1 expression in NECs suggests a possible role in their normal development and differentiation
20513429 Depletion of TTF-I recapitulates the effects of ARF on ribosomal RNA synthesis and is rescued by the introduction of a TTF-I transgene.

AA Sequence

MEGESSRFEIHTPVSDKKKKKCSIHKERPQKHSHEIFRDSSLVNEQSQITRRKKRKKDFQHLISSPLKKS      1 - 70
RICDETANATSTLKKRKKRRYSALEVDEEAGVTVVLVDKENINNTPKHFRKDVDVVCVDMSIEQKLPRKP     71 - 140
KTDKFQVLAKSHAHKSEALHSKVREKKNKKHQRKAASWESQRARDTLPQSESHQEESWLSVGPGGEITEL    141 - 210
PASAHKNKSKKKKKKSSNREYETLAMPEGSQAGREAGTDMQESQPTVGLDDETPQLLGPTHKKKSKKKKK    211 - 280
KKSNHQEFEALAMPEGSQVGSEVGADMQESRPAVGLHGETAGIPAPAYKNKSKKKKKKSNHQEFEAVAMP    281 - 350
ESLESAYPEGSQVGSEVGTVEGSTALKGFKESNSTKKKSKKRKLTSVKRARVSGDDFSVPSKNSESTLFD    351 - 420
SVEGDGAMMEEGVKSRPRQKKTQACLASKHVQEAPRLEPANEEHNVETAEDSEIRYLSADSGDADDSDAD    421 - 490
LGSAVKQLQEFIPNIKDRATSTIKRMYRDDLERFKEFKAQGVAIKFGKFSVKENKQLEKNVEDFLALTGI    491 - 560
ESADKLLYTDRYPEEKSVITNLKRRYSFRLHIGRNIARPWKLIYYRAKKMFDVNNYKGRYSEGDTEKLKM    561 - 630
YHSLLGNDWKTIGEMVARSSLSVALKFSQISSQRNRGAWSKSETRKLIKAVEEVILKKMSPQELKEVDSK    631 - 700
LQENPESCLSIVREKLYKGISWVEVEAKVQTRNWMQCKSKWTEILTKRMTNGRRIYYGMNALRAKVSLIE    701 - 770
RLYEINVEDTNEIDWEDLASAIGDVPPSYVQTKFSRLKAVYVPFWQKKTFPEIIDYLYETTLPLLKEKLE    771 - 840
KMMEKKGTKIQTPAAPKQVFPFRDIFYYEDDSEGEDIEKESEGQAPCMAHACNSSTLGGQGRWII         841 - 905
//

Text Mined References (35)

PMID Year Title
26905105 Dual surrogate markers for rapid prediction of epidermal growth factor receptor mutation status in advanced adenocarcinoma of the lung: A novel approach in resource-limited setting.
26823891 2015 KRAS mutation-positive bronchial surface epithelium (BSE)-type lung adenocarcinoma with strong expression of TTF-1: a case providing a further insight as for the role of TTF-1 in the oncogenesis.
26469326 2016 CDX-2 Expression in Primary Lung Adenocarcinoma.
26281863 2016 An immunohistochemical comparison of two TTF-1 monoclonal antibodies in atypical squamous lesions and sarcomatoid carcinoma of the lung, and pleural malignant mesothelioma.
26036188 2015 Overexpression of Transcription Termination Factor 1 is Associated with a Poor Prognosis in Patients with Colorectal Cancer.
25982999 2015 The expression of TTF-1 and Napsin A in early-stage lung adenocarcinoma correlates with the results of surgical treatment.
25878335 2015 An Integrated Molecular Analysis of Lung Adenocarcinomas Identifies Potential Therapeutic Targets among TTF1-Negative Tumors, Including DNA Repair Proteins and Nrf2.
25722034 Co-expression of TTF-1 and neuroendocrine markers in the human fetal lung and pulmonary neuroendocrine tumors.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23787483 2013 A mutation in TTF1/NKX2.1 is associated with familial neuroendocrine cell hyperplasia of infancy.
More...