Property Summary

NCBI Gene PubMed Count 54
Grant Count 174
R01 Count 79
Funding $22,686,146.92
PubMed Score 131.91
PubTator Score 114.28

Knowledge Summary

Patent (29,163)

Expression

  Differential Expression (16)

Synonym

Accession Q15349 B3KTK9 Q15419 Q59GJ3 Q5TI68 Q96J38 Q9UJN5 S6K-alpha-2
Symbols RSK
HU-2
RSK3
p90RSK2
p90-RSK3
pp90RSK3
MAPKAPK1C
S6K-alpha
S6K-alpha2

Gene

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (17)

PMID Text
26977024 RSK1 and 3 but not RSK2 are down-regulated in breast tumour and are associated with disease progression. RSK may be a key component in the progression and metastasis of breast cancer.
24403857 Kinome screening revealed RPS6KA2 expression, in human pancreatic cancer cells, protects against erlotinib induced apoptosis.
23727904 genetic association study in Han population in China: Data suggest that SNPs in RSK3 (rs2229712) and in MEK1 (rs28730804) demonstrate gene-gene interaction that affects antidepressant drug outcome in female patients with major depressive disorder.
23635776 Overexpression of RSK3 or RSK4 supports tumor cell proliferation upon PI3K inhibition both in vitro and in vivo therby contributing to drug resistance.
23564320 Data indicate that S6 kinase 2 (S6K2) can phosphorylate histone H3 at position Thr45, which may play a role during cell proliferation and/or differentiation.
21527514 p90RSK2 is dispensable for BCR-ABL-induced myeloid leukemia, but may be required for pathogenesis and lineage determination in FLT3-internal tandem duplication-induced hematopoietic transformation.
21035469 Data show that genetic variation in RPS6KA1, RPS6KA2, and PRS6KB2 were associated with risk of developing colon cancer while only genetic variation in RPS6KA2 was associated with altering risk of rectal cancer.
21035469 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16895915 there is a functional link between S6K1 II and CK2 signaling, which involves the regulation of S6K1 II nuclear export by CK2-mediated phosphorylation of Ser-17
More...

AA Sequence

MDLSMKKFAVRRFFSVYLRRKSRSKSSSLSRLEEEGVVKEIDISHHVKEGFEKADPSQFELLKVLGQGSY      1 - 70
GKVFLVRKVKGSDAGQLYAMKVLKKATLKVRDRVRSKMERDILAEVNHPFIVKLHYAFQTEGKLYLILDF     71 - 140
LRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKITDFGLSKEAI    141 - 210
DHDKRAYSFCGTIEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGSLPFQGKDRKETMALILKAKLGMPQ    211 - 280
FLSGEAQSLLRALFKRNPCNRLGAGIDGVEEIKRHPFFVTIDWNTLYRKEIKPPFKPAVGRPEDTFHFDP    281 - 350
EFTARTPTDSPGVPPSANAHHLFRGFSFVASSLIQEPSQQDLHKVPVHPIVQQLHGNNIHFTDGYEIKED    351 - 420
IGVGSYSVCKRCVHKATDTEYAVKIIDKSKRDPSEEIEILLRYGQHPNIITLKDVYDDGKFVYLVMELMR    421 - 490
GGELLDRILRQRYFSEREASDVLCTITKTMDYLHSQGVVHRDLKPSNILYRDESGSPESIRVCDFGFAKQ    491 - 560
LRAGNGLLMTPCYTANFVAPEVLKRQGYDAACDIWSLGILLYTMLAGFTPFANGPDDTPEEILARIGSGK    561 - 630
YALSGGNWDSISDAAKDVVSKMLHVDPHQRLTAMQVLKHPWVVNREYLSPNQLSRQDVHLVKGAMAATYF    631 - 700
ALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTRL                                         701 - 733
//

Text Mined References (58)

PMID Year Title
26977024 2016 The Clinical Implications of RSK1-3 in Human Breast Cancer.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25189868 2015 Gene-smoking interactions identify several novel blood pressure loci in the Framingham Heart Study.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24556642 2014 Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries.
24403857 2013 Synthetic lethality screen identifies RPS6KA2 as modifier of epidermal growth factor receptor activity in pancreatic cancer.
23727904 2013 Kinase gene haplotypes and gene-gene interactions in the Ras-Raf-MAPK signaling pathway: association with antidepressant remission.
23635776 2013 RSK3/4 mediate resistance to PI3K pathway inhibitors in breast cancer.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23564320 2014 S6 kinase 2 is bound to chromatin-nuclear matrix cellular fractions and is able to phosphorylate histone H3 at threonine 45 in vitro and in vivo.
More...