Property Summary

NCBI Gene PubMed Count 27
PubMed Score 1212.43
PubTator Score 24.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
group 3 medulloblastoma -1.300 3.1e-03
medulloblastoma, large-cell -1.200 3.8e-03
non primary Sjogren syndrome sicca 1.100 2.2e-02
osteosarcoma 4.435 8.4e-10
ovarian cancer 1.700 3.3e-10
posterior fossa group B ependymoma 1.100 1.7e-04
psoriasis 2.400 4.1e-05
Waldenstrons macroglobulinemia -1.015 1.5e-02

Gene RIF (19)

AA Sequence

MMKFRFRRQGADPQREKLKQELFAFNKTVEHGFPNQPSALAFDPELRIMAIGTRSGAVKIYGAPGVEFTG      1 - 70
LHRDAATVTQMHFLTGQGRLLSLLDDSSLHLWEIVHHNGCAHLEEALSFQLPSRPGFDGASAPLSLTRVT     71 - 140
VVLLVAASDIAALGTEGSSVFFLDVTTLTLLEGQTLAPGEVLRSVPDDYRCGKALGPVESLQGHLRDPTK    141 - 210
ILIGYSRGLLVIWNQASQCVDHIFLGNQQLESLCWGRDSSTVVSSHSDGSYAVWSVDAGSFPTLQPTVAT    211 - 280
TPYGPFPCKAINKILWRNCESGGHFIIFSGGMPRASYGDRHCVSVLRAETLVTLDFTSRIIDFFTVHSTR    281 - 350
PEDEFDDPQALAVLLEEELVVLDLQTPGWPAVPAPYLAPLHSSAITCSAHVASVPAKLWARIVSAGEQQS    351 - 420
PQPVSSALSWPITGGRNLAQEPSQRGLLLTGHEDGTVRFWDASGVALRPLYKLSTAGLFQTDCEHADSLA    421 - 490
QAAEDDWPPFRKVGCFDPYSDDPRLGVQKVALCKYTAQMVVAGTAGQVLVLELSDVPVEQAVSVAIIDLL    491 - 560
QDREGFTWKGHERLSPRTGPLPWPAGFQPRVLVQCLPPAAVTAVTLHTEWSLVAFGTSHGFGLFDYQRKS    561 - 630
PVLARCTLHPNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSRVSGKKRAANASSKLQEANAQLAEQACPHD    631 - 700
VEMTPVQRRIEPRSADDSLSGVVRCLYFADTFLRDGAHHGPTMWAGTNSGSVFAYALEVPAAAVGGEKRP    701 - 770
EQAVEAVLGKEVQLMHRAPVVAIAVLDGRGRPLPEPYEASRDLAQAPDMQGGHAVLIASEEQFKVFTLPK    771 - 840
VSAKTKFKLTAHEGCRVRKVALATFASVACEDYAETCLACLTNLGDVHVFSVPGLRPQVHYSCIRKEDIS    841 - 910
GIASCVFTRHGQGFYLISPSEFERFSLSARNITEPLCSLDINWPRDATQASYRIRESPKLSQANGTPSIL    911 - 980
LAPQSLDGSPDPAHSMGPDTPEPPEAALSPMSIDSATSADTTLDTTGDVTVEDVKDFLGSSEESEKNLRN    981 - 1050
LAEDEAHACAILIK                                                           1051 - 1064
//

Text Mined References (29)

PMID Year Title