Property Summary

NCBI Gene PubMed Count 25
Grant Count 44
R01 Count 34
Funding $5,786,342.63
PubMed Score 1151.09
PubTator Score 24.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.015 0.015
psoriasis 2.400 0.000
osteosarcoma 4.435 0.000
medulloblastoma, large-cell -1.200 0.004
group 3 medulloblastoma -1.300 0.003
posterior fossa group B ependymoma 1.100 0.000
non primary Sjogren syndrome sicca 1.100 0.022
ovarian cancer 1.700 0.000

Gene RIF (17)

PMID Text
26662669 Reduced expression of Hugl 1 predicts poor survival in lung SqCC patients. The expression of Hugl 1 was inversely correlated with both overall survival rate and tumor stage.
26341367 this study provides the evidence that Hugl-1 inhibits glioma cell growth in intracranial model of nude mice, suggesting that Hugl-1 might be a potential tumor target for glioma therapy.
25982280 Our results support the growing appreciation that the tumour regulatory functions of Scribble, and other polarity protein family members, are context dependent.
25426552 Lgl1 has a role in inhibiting glioblastoma
23907540 PTEN loss leads to the phosphorylation and inactivation of Lgl by atypical protein kinase C in glioblastoma cells.
23864775 Suggest that Hugl-1 induces growth suppression and apoptosis in a human esophageal squamous cell carcinoma cell line both in vitro and in vivo.
23277453 inactivation of Llgl1 enhances hematopoietic stem cells self-renewal and fitness and is associated with unfavorable outcome in human acute myeloid leukemia
23110097 Hugl1 and Hugl2 play an essential role in the maintenance of breast epithelial polarity and differentiated cell morphology, as well as growth control.
22843887 Preservation of HUGL-1 expression in pancreatic adenocarcinoma is a good prognostic factor that contributes to a better overall survival
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MMKFRFRRQGADPQREKLKQELFAFNKTVEHGFPNQPSALAFDPELRIMAIGTRSGAVKIYGAPGVEFTG      1 - 70
LHRDAATVTQMHFLTGQGRLLSLLDDSSLHLWEIVHHNGCAHLEEALSFQLPSRPGFDGASAPLSLTRVT     71 - 140
VVLLVAASDIAALGTEGSSVFFLDVTTLTLLEGQTLAPGEVLRSVPDDYRCGKALGPVESLQGHLRDPTK    141 - 210
ILIGYSRGLLVIWNQASQCVDHIFLGNQQLESLCWGRDSSTVVSSHSDGSYAVWSVDAGSFPTLQPTVAT    211 - 280
TPYGPFPCKAINKILWRNCESGGHFIIFSGGMPRASYGDRHCVSVLRAETLVTLDFTSRIIDFFTVHSTR    281 - 350
PEDEFDDPQALAVLLEEELVVLDLQTPGWPAVPAPYLAPLHSSAITCSAHVASVPAKLWARIVSAGEQQS    351 - 420
PQPVSSALSWPITGGRNLAQEPSQRGLLLTGHEDGTVRFWDASGVALRPLYKLSTAGLFQTDCEHADSLA    421 - 490
QAAEDDWPPFRKVGCFDPYSDDPRLGVQKVALCKYTAQMVVAGTAGQVLVLELSDVPVEQAVSVAIIDLL    491 - 560
QDREGFTWKGHERLSPRTGPLPWPAGFQPRVLVQCLPPAAVTAVTLHTEWSLVAFGTSHGFGLFDYQRKS    561 - 630
PVLARCTLHPNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSRVSGKKRAANASSKLQEANAQLAEQACPHD    631 - 700
VEMTPVQRRIEPRSADDSLSGVVRCLYFADTFLRDGAHHGPTMWAGTNSGSVFAYALEVPAAAVGGEKRP    701 - 770
EQAVEAVLGKEVQLMHRAPVVAIAVLDGRGRPLPEPYEASRDLAQAPDMQGGHAVLIASEEQFKVFTLPK    771 - 840
VSAKTKFKLTAHEGCRVRKVALATFASVACEDYAETCLACLTNLGDVHVFSVPGLRPQVHYSCIRKEDIS    841 - 910
GIASCVFTRHGQGFYLISPSEFERFSLSARNITEPLCSLDINWPRDATQASYRIRESPKLSQANGTPSIL    911 - 980
LAPQSLDGSPDPAHSMGPDTPEPPEAALSPMSIDSATSADTTLDTTGDVTVEDVKDFLGSSEESEKNLRN    981 - 1050
LAEDEAHACAILIK                                                           1051 - 1064
//

Text Mined References (27)

PMID Year Title
26662669 2015 Reduced Expression of Hugl 1 Contributes to the Progression of Lung Squamous Cell Carcinoma.
26341367 2015 Hugl-1 inhibits glioma cell growth in intracranial model.
25982280 2016 Scribble acts as an oncogene in E?-myc-driven lymphoma.
25426552 2014 Inhibition of glioblastoma malignancy by Lgl1.
23907540 2013 PTEN loss represses glioblastoma tumor initiating cell differentiation via inactivation of Lgl1.
23864775 2013 Hugl-1 induces apoptosis in esophageal carcinoma cells both in vitro and in vivo.
23277453 2013 The cell fate determinant Llgl1 influences HSC fitness and prognosis in AML.
23110097 2012 Hugl1 and Hugl2 in mammary epithelial cells: polarity, proliferation, and differentiation.
22843887 2012 Preservation of HUGL-1 expression as a favourable prognostic factor in pancreatic carcinoma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...